Details of the Target
General Information of Target
| Target ID | LDTP00832 | |||||
|---|---|---|---|---|---|---|
| Target Name | NADH dehydrogenase 1 beta subcomplex subunit 3 (NDUFB3) | |||||
| Gene Name | NDUFB3 | |||||
| Gene ID | 4709 | |||||
| Synonyms |
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3; Complex I-B12; CI-B12; NADH-ubiquinone oxidoreductase B12 subunit |
|||||
| 3D Structure | ||||||
| Sequence |
MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKS
VSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Complex I NDUFB3 subunit family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function |
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K39(2.12) | LDD0277 | [1] | |
|
ATP probe Probe Info |
![]() |
K34(0.00); K35(0.00) | LDD0199 | [2] | |
PAL-AfBPP Probe
The Interaction Atlas With This Target
References
















































































































































































