Details of the Target
General Information of Target
| Target ID | LDTP13189 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cytochrome b-c1 complex subunit 9 (UQCR10) | |||||
| Gene Name | UQCR10 | |||||
| Gene ID | 29796 | |||||
| Synonyms |
UCRC; Cytochrome b-c1 complex subunit 9; Complex III subunit 9; Complex III subunit X; Cytochrome c1 non-heme 7 kDa protein; Ubiquinol-cytochrome c reductase complex 7.2 kDa protein |
|||||
| 3D Structure | ||||||
| Sequence |
MAESAPARHRRKRRSTPLTSSTLPSQATEKSSYFQTTEISLWTVVAAIQAVEKKMESQAA
RLQSLEGRTGTAEKKLADCEKMAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRN RNFWILRLPPGSKGEAPKVSRSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSL KVLGQTEGEAELGTEMLGDLEEEGPGGAHPAGGVMIKQELQYTQEGPADLPGEFSCIAEE QAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPVGSRVPSSSRTVGCPKQKSHRQVQLDQ ECGQGLKLKKDTSRPYECSECEITFRYKQQLATHLRSHSGWGSCTPEEPEESLRPRPRLK PQTKKAKLHQCDVCLRSFSCKVSLVTHQRCHLQEGPSAGQHVQERFSPNSLVALPGHIPW RKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCTECEKSFVQKQHLLQHQKIHQRE RGGLALEPGRPNGLL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
UQCR10/QCR9 family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function |
Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
CHEMBL5175495 Probe Info |
![]() |
6.16 | LDD0196 | [1] | |
|
N1 Probe Info |
![]() |
100.00 | LDD0242 | [2] | |
|
TH211 Probe Info |
![]() |
Y11(19.96) | LDD0260 | [3] | |
|
STPyne Probe Info |
![]() |
K54(10.00); K57(5.73); K59(10.00) | LDD0277 | [4] | |
|
Jackson_14 Probe Info |
![]() |
2.22 | LDD0123 | [5] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [6] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [7] | |
|
W1 Probe Info |
![]() |
D37(0.00); D45(0.00); Y44(0.00); N48(0.00) | LDD0236 | [8] | |
PAL-AfBPP Probe
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Drug(s) Related To This Target
Investigative
References
























































































































































