Details of the Target
General Information of Target
Target ID | LDTP13902 | |||||
---|---|---|---|---|---|---|
Target Name | Cytochrome c oxidase assembly factor 3 homolog, mitochondrial (COA3) | |||||
Gene Name | COA3 | |||||
Gene ID | 28958 | |||||
Synonyms |
CCDC56; MITRAC12; Cytochrome c oxidase assembly factor 3 homolog, mitochondrial; Coiled-coil domain-containing protein 56; Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 12 kDa
|
|||||
3D Structure | ||||||
Sequence |
MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNG
NQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLT QVAAS |
|||||
Target Bioclass |
Other
|
|||||
Family |
COA3 family
|
|||||
Subcellular location |
Mitochondrion inner membrane
|
|||||
Function |
Core component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. MITRAC complexes regulate both translation of mitochondrial encoded components and assembly of nuclear-encoded components imported in mitochondrion. Required for efficient translation of MT-CO1 and mitochondrial respiratory chain complex IV assembly.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K48(6.75) | LDD0277 | [1] | |
AZ-9 Probe Info |
![]() |
D86(10.00) | LDD2209 | [2] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0221 | [3] | |
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [4] | |
NHS Probe Info |
![]() |
N.A. | LDD0010 | [5] |
PAL-AfBPP Probe
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References