Details of the Target
General Information of Target
| Target ID | LDTP18373 | |||||
|---|---|---|---|---|---|---|
| Target Name | Thioredoxin-related transmembrane protein 4 (TMX4) | |||||
| Gene Name | TMX4 | |||||
| Gene ID | 56255 | |||||
| Synonyms |
KIAA1162; TXNDC13; Thioredoxin-related transmembrane protein 4; Thioredoxin domain-containing protein 13 |
|||||
| 3D Structure | ||||||
| Sequence |
MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPK
TTVYVVEDQRRDELGPSTCLTACWTALCCCCLWDMLT |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus inner membrane
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C326(0.99) | LDD0304 | [1] | |
|
m-APA Probe Info |
![]() |
12.64 | LDD0403 | [2] | |
|
HPAP Probe Info |
![]() |
5.18 | LDD0062 | [3] | |
|
Alkyne-RA190 Probe Info |
![]() |
6.32 | LDD0299 | [1] | |
|
DBIA Probe Info |
![]() |
C326(1.04) | LDD1492 | [4] | |
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [5] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2224 | [5] | |
PAL-AfBPP Probe
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0156 | Aniline | NCI-H1299 | 12.64 | LDD0403 | [2] |
| LDCM0022 | KB02 | HEK-293T | C326(1.04) | LDD1492 | [4] |
| LDCM0023 | KB03 | HEK-293T | C326(1.13) | LDD1497 | [4] |
| LDCM0024 | KB05 | HEK-293T | C326(1.05) | LDD1502 | [4] |
| LDCM0014 | Panhematin | HEK-293T | 5.18 | LDD0062 | [3] |
| LDCM0131 | RA190 | MM1.R | 6.32 | LDD0299 | [1] |
References





































































































































