Details of the Target
General Information of Target
| Target ID | LDTP01804 | |||||
|---|---|---|---|---|---|---|
| Target Name | ATP synthase subunit a (MT-ATP6) | |||||
| Gene Name | MT-ATP6 | |||||
| Gene ID | 4508 | |||||
| Synonyms |
ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6 |
|||||
| 3D Structure | ||||||
| Sequence |
MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTM
HNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSK IKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLA MSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
ATPase A chain family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function |
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TH211 Probe Info |
![]() |
Y36(6.57) | LDD0260 | [1] | |
|
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [2] | |
|
TPP-AC Probe Info |
![]() |
N.A. | LDD0427 | [3] | |
PAL-AfBPP Probe
The Interaction Atlas With This Target
The Drug(s) Related To This Target
Approved
References
















































































































