Details of the Target
General Information of Target
Target ID | LDTP02645 | |||||
---|---|---|---|---|---|---|
Target Name | Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1) | |||||
Gene Name | COX4I1 | |||||
Gene ID | 1327 | |||||
Synonyms |
COX4; Cytochrome c oxidase subunit 4 isoform 1, mitochondrial; Cytochrome c oxidase polypeptide IV; Cytochrome c oxidase subunit IV isoform 1; COX IV-1 |
|||||
3D Structure | ||||||
Sequence |
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQK
ALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMW QKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
Cytochrome c oxidase IV family
|
|||||
Subcellular location |
Mitochondrion inner membrane
|
|||||
Function |
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
HDSF-alk Probe Info |
![]() |
2.18 | LDD0197 | [1] | |
FBPP2 Probe Info |
![]() |
2.62 | LDD0318 | [2] | |
TH211 Probe Info |
![]() |
Y38(9.15) | LDD0260 | [3] | |
C-Sul Probe Info |
![]() |
4.23 | LDD0066 | [4] | |
ONAyne Probe Info |
![]() |
K87(0.00); K53(0.00) | LDD0273 | [5] | |
Probe 1 Probe Info |
![]() |
Y126(6.99) | LDD3495 | [6] | |
HPAP Probe Info |
![]() |
3.13 | LDD0063 | [7] | |
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [8] | |
ATP probe Probe Info |
![]() |
K60(0.00); K87(0.00); K29(0.00); K149(0.00) | LDD0199 | [9] | |
m-APA Probe Info |
![]() |
H51(0.00); H44(0.00) | LDD2231 | [8] | |
NHS Probe Info |
![]() |
K60(0.00); K29(0.00); K87(0.00) | LDD0010 | [10] | |
SF Probe Info |
![]() |
N.A. | LDD0028 | [11] | |
STPyne Probe Info |
![]() |
K149(0.00); K159(0.00) | LDD0009 | [10] | |
1c-yne Probe Info |
![]() |
N.A. | LDD0228 | [12] | |
Acrolein Probe Info |
![]() |
H44(0.00); H51(0.00); H24(0.00) | LDD0217 | [13] | |
Crotonaldehyde Probe Info |
![]() |
H54(0.00); H44(0.00); H24(0.00) | LDD0219 | [13] | |
Methacrolein Probe Info |
![]() |
H44(0.00); H54(0.00); H24(0.00) | LDD0218 | [13] | |
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [14] |
PAL-AfBPP Probe
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0108 | Chloroacetamide | HeLa | H51(0.00); H44(0.00); H24(0.00); H54(0.00) | LDD0222 | [13] |
LDCM0107 | IAA | HeLa | H44(0.00); H51(0.00); H24(0.00); H54(0.00) | LDD0221 | [13] |
LDCM0109 | NEM | HeLa | H44(0.00); H51(0.00); H24(0.00); H54(0.00) | LDD0223 | [13] |
LDCM0014 | Panhematin | K562 | 3.13 | LDD0063 | [7] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Cytochrome c oxidase subunit 1 (MT-CO1) | Heme-copper respiratory oxidase family | P00395 |
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Syntenin-1 (SDCBP) | . | O00560 |
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Krueppel-like factor 11 (KLF11) | Sp1 C2H2-type zinc-finger protein family | O14901 |
References