General Information of Target

Target ID LDTP04471
Target Name Ribosomal protein S6 kinase alpha-3 (RPS6KA3)
Gene Name RPS6KA3
Gene ID 6197
Synonyms
ISPK1; MAPKAPK1B; RSK2; Ribosomal protein S6 kinase alpha-3; S6K-alpha-3; EC 2.7.11.1; 90 kDa ribosomal protein S6 kinase 3; p90-RSK 3; p90RSK3; Insulin-stimulated protein kinase 1; ISPK-1; MAP kinase-activated protein kinase 1b; MAPK-activated protein kinase 1b; MAPKAP kinase 1b; MAPKAPK-1b; Ribosomal S6 kinase 2; RSK-2; pp90RSK2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGH
EKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERD
ILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALA
LDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVV
NRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLR
MLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFYFDPE
FTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTD
GYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLK
DVYDDGKYVYVVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDL
KPSNILYVDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACD
IWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKML
HVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEP
VGRSTLAQRRGIKKITSTAL
Target Type
Patented-recorded
Target Bioclass
Enzyme
Family
Protein kinase superfamily, AGC Ser/Thr protein kinase family, S6 kinase subfamily
Subcellular location
Nucleus
Function
Serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of the transcription factors CREB1, ETV1/ER81 and NR4A1/NUR77, regulates translation through RPS6 and EIF4B phosphorylation, and mediates cellular proliferation, survival, and differentiation by modulating mTOR signaling and repressing pro-apoptotic function of BAD and DAPK1. In fibroblast, is required for EGF-stimulated phosphorylation of CREB1 and histone H3 at 'Ser-10', which results in the subsequent transcriptional activation of several immediate-early genes. In response to mitogenic stimulation (EGF and PMA), phosphorylates and activates NR4A1/NUR77 and ETV1/ER81 transcription factors and the cofactor CREBBP. Upon insulin-derived signal, acts indirectly on the transcription regulation of several genes by phosphorylating GSK3B at 'Ser-9' and inhibiting its activity. Phosphorylates RPS6 in response to serum or EGF via an mTOR-independent mechanism and promotes translation initiation by facilitating assembly of the preinitiation complex. In response to insulin, phosphorylates EIF4B, enhancing EIF4B affinity for the EIF3 complex and stimulating cap-dependent translation. Is involved in the mTOR nutrient-sensing pathway by directly phosphorylating TSC2 at 'Ser-1798', which potently inhibits TSC2 ability to suppress mTOR signaling, and mediates phosphorylation of RPTOR, which regulates mTORC1 activity and may promote rapamycin-sensitive signaling independently of the PI3K/AKT pathway. Mediates cell survival by phosphorylating the pro-apoptotic proteins BAD and DAPK1 and suppressing their pro-apoptotic function. Promotes the survival of hepatic stellate cells by phosphorylating CEBPB in response to the hepatotoxin carbon tetrachloride (CCl4). Is involved in cell cycle regulation by phosphorylating the CDK inhibitor CDKN1B, which promotes CDKN1B association with 14-3-3 proteins and prevents its translocation to the nucleus and inhibition of G1 progression. In LPS-stimulated dendritic cells, is involved in TLR4-induced macropinocytosis, and in myeloma cells, acts as effector of FGFR3-mediated transformation signaling, after direct phosphorylation at Tyr-529 by FGFR3. Negatively regulates EGF-induced MAPK1/3 phosphorylation via phosphorylation of SOS1. Phosphorylates SOS1 at 'Ser-1134' and 'Ser-1161' that create YWHAB and YWHAE binding sites and which contribute to the negative regulation of MAPK1/3 phosphorylation. Phosphorylates EPHA2 at 'Ser-897', the RPS6KA-EPHA2 signaling pathway controls cell migration. Acts as a regulator of osteoblast differentiation by mediating phosphorylation of ATF4, thereby promoting ATF4 transactivation activity.
TTD ID
T03279
Uniprot ID
P51812
DrugMap ID
TTUM2ZR
Ensemble ID
ENST00000379565.9
HGNC ID
HGNC:10432
ChEMBL ID
CHEMBL2345

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 30 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info 
15.00  LDD0402  [1]
YN-1
 Probe Info 
100.00  LDD0444  [2]
YN-4
 Probe Info 
100.00  LDD0445  [2]
STPyne
 Probe Info 
K57(10.00); K72(5.26); K81(1.22); K86(3.69)  LDD0277  [3]
BTD
 Probe Info 
C560(2.83)  LDD1699  [4]
ONAyne
 Probe Info 
K216(9.09)  LDD0275  [3]
Probe 1
 Probe Info 
Y483(22.80); Y707(17.13)  LDD3495  [5]
Dasatinib-CA-4PAP
 Probe Info 
7.00  LDD0270  [6]
THZ1-DTB
 Probe Info 
C579(1.18)  LDD0460  [7]
Sulforaphane-probe2
 Probe Info 
2.33  LDD0160  [8]
Johansson_61
 Probe Info 
_(4.47)  LDD1485  [9]
IMP-1710
 Probe Info 
2.62  LDD0040  [10]
AHL-Pu-1
 Probe Info 
C560(2.29); C436(2.00); C229(2.79)  LDD0169  [11]
EA-probe
 Probe Info 
N.A.  LDD0440  [12]
DBIA
 Probe Info 
C229(5.81); C560(9.58)  LDD0209  [13]
HHS-475
 Probe Info 
Y488(0.88)  LDD0264  [14]
ATP probe
 Probe Info 
K195(0.00); K541(0.00); K216(0.00); K81(0.00)  LDD0199  [15]
4-Iodoacetamidophenylacetylene
 Probe Info 
N.A.  LDD0038  [16]
IA-alkyne
 Probe Info 
N.A.  LDD0032  [17]
IPIAA_L
 Probe Info 
N.A.  LDD0031  [18]
Lodoacetamide azide
 Probe Info 
N.A.  LDD0037  [16]
ATP probe
 Probe Info 
N.A.  LDD0035  [19]
NAIA_4
 Probe Info 
N.A.  LDD2226  [20]
IPM
 Probe Info 
C560(0.00); C579(0.00); C436(0.00)  LDD0147  [21]
TFBX
 Probe Info 
C560(0.00); C436(0.00); C579(0.00)  LDD0148  [21]
VSF
 Probe Info 
C579(0.00); C436(0.00)  LDD0007  [22]
1c-yne
 Probe Info 
K195(0.00); K637(0.00); K72(0.00)  LDD0228  [23]
W1
 Probe Info 
C579(0.00); C436(0.00)  LDD0236  [24]
AOyne
 Probe Info 
9.70  LDD0443  [25]
NAIA_5
 Probe Info 
C579(0.00); C560(0.00)  LDD2223  [20]
PAL-AfBPP Probe
Click To Hide/Show 42 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C007
 Probe Info 
11.39  LDD1716  [26]
C040
 Probe Info 
8.75  LDD1740  [26]
C072
 Probe Info 
10.56  LDD1768  [26]
C106
 Probe Info 
25.99  LDD1793  [26]
C112
 Probe Info 
17.88  LDD1799  [26]
C143
 Probe Info 
14.03  LDD1825  [26]
C145
 Probe Info 
8.17  LDD1827  [26]
C161
 Probe Info 
14.52  LDD1841  [26]
C174
 Probe Info 
5.62  LDD1854  [26]
C196
 Probe Info 
13.64  LDD1872  [26]
C218
 Probe Info 
16.34  LDD1892  [26]
C219
 Probe Info 
5.62  LDD1893  [26]
C229
 Probe Info 
11.08  LDD1902  [26]
C233
 Probe Info 
8.94  LDD1906  [26]
C235
 Probe Info 
17.39  LDD1908  [26]
C240
 Probe Info 
11.31  LDD1913  [26]
C280
 Probe Info 
10.20  LDD1950  [26]
C293
 Probe Info 
21.41  LDD1963  [26]
C361
 Probe Info 
23.92  LDD2022  [26]
C366
 Probe Info 
7.67  LDD2027  [26]
C367
 Probe Info 
6.87  LDD2028  [26]
C391
 Probe Info 
14.22  LDD2050  [26]
C418
 Probe Info 
11.88  LDD2073  [26]
C429
 Probe Info 
34.06  LDD2084  [26]
C433
 Probe Info 
7.89  LDD2088  [26]
FFF probe12
 Probe Info 
5.66  LDD0474  [27]
FFF probe13
 Probe Info 
20.00  LDD0475  [27]
FFF probe14
 Probe Info 
20.00  LDD0477  [27]
FFF probe15
 Probe Info 
6.37  LDD0478  [27]
FFF probe2
 Probe Info 
12.96  LDD0463  [27]
FFF probe3
 Probe Info 
16.34  LDD0464  [27]
FFF probe4
 Probe Info 
14.29  LDD0466  [27]
FFF probe6
 Probe Info 
14.21  LDD0467  [27]
FFF probe7
 Probe Info 
14.08  LDD0483  [27]
FFF probe9
 Probe Info 
14.46  LDD0470  [27]
JN0003
 Probe Info 
20.00  LDD0469  [27]
VE-P
 Probe Info 
N.A.  LDD0396  [28]
A-DA
 Probe Info 
3.21  LDD0331  [29]
Kambe_26
 Probe Info 
6.24  LDD0127  [30]
DA-2
 Probe Info 
N.A.  LDD0072  [31]
OEA-DA
 Probe Info 
20.00  LDD0046  [29]
STS-1
 Probe Info 
N.A.  LDD0068  [32]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C560(0.88)  LDD2117  [4]
 LDCM0026  4SU-RNA+native RNA HEK-293T C560(2.29); C436(2.00); C229(2.79)  LDD0169  [11]
 LDCM0214  AC1 HEK-293T C579(1.06); C599(0.95)  LDD1507  [33]
 LDCM0215  AC10 HEK-293T C579(1.06)  LDD1508  [33]
 LDCM0226  AC11 HEK-293T C579(1.06)  LDD1509  [33]
 LDCM0237  AC12 HEK-293T C579(1.04)  LDD1510  [33]
 LDCM0259  AC14 HEK-293T C579(0.99)  LDD1512  [33]
 LDCM0270  AC15 HEK-293T C579(0.95)  LDD1513  [33]
 LDCM0276  AC17 HEK-293T C579(1.08); C599(1.20)  LDD1515  [33]
 LDCM0277  AC18 HEK-293T C579(1.06)  LDD1516  [33]
 LDCM0278  AC19 HEK-293T C579(0.98)  LDD1517  [33]
 LDCM0279  AC2 HEK-293T C579(1.06)  LDD1518  [33]
 LDCM0280  AC20 HEK-293T C579(0.90)  LDD1519  [33]
 LDCM0281  AC21 HEK-293T C579(0.87)  LDD1520  [33]
 LDCM0282  AC22 HEK-293T C579(0.96)  LDD1521  [33]
 LDCM0283  AC23 HEK-293T C579(0.91)  LDD1522  [33]
 LDCM0284  AC24 HEK-293T C579(0.96)  LDD1523  [33]
 LDCM0285  AC25 HEK-293T C579(1.07); C599(1.48)  LDD1524  [33]
 LDCM0286  AC26 HEK-293T C579(1.04)  LDD1525  [33]
 LDCM0287  AC27 HEK-293T C579(1.16)  LDD1526  [33]
 LDCM0288  AC28 HEK-293T C579(0.83)  LDD1527  [33]
 LDCM0289  AC29 HEK-293T C579(1.01)  LDD1528  [33]
 LDCM0290  AC3 HEK-293T C579(0.99)  LDD1529  [33]
 LDCM0291  AC30 HEK-293T C579(0.96)  LDD1530  [33]
 LDCM0292  AC31 HEK-293T C579(0.88)  LDD1531  [33]
 LDCM0293  AC32 HEK-293T C579(0.98)  LDD1532  [33]
 LDCM0294  AC33 HEK-293T C579(0.94); C599(1.30)  LDD1533  [33]
 LDCM0295  AC34 HEK-293T C579(1.00)  LDD1534  [33]
 LDCM0296  AC35 HEK-293T C579(0.98)  LDD1535  [33]
 LDCM0297  AC36 HEK-293T C579(0.92)  LDD1536  [33]
 LDCM0298  AC37 HEK-293T C579(1.00)  LDD1537  [33]
 LDCM0299  AC38 HEK-293T C579(1.02)  LDD1538  [33]
 LDCM0300  AC39 HEK-293T C579(0.85)  LDD1539  [33]
 LDCM0301  AC4 HEK-293T C579(1.02)  LDD1540  [33]
 LDCM0302  AC40 HEK-293T C579(1.03)  LDD1541  [33]
 LDCM0303  AC41 HEK-293T C579(0.94); C599(1.05)  LDD1542  [33]
 LDCM0304  AC42 HEK-293T C579(1.16)  LDD1543  [33]
 LDCM0305  AC43 HEK-293T C579(0.94)  LDD1544  [33]
 LDCM0306  AC44 HEK-293T C579(1.04)  LDD1545  [33]
 LDCM0307  AC45 HEK-293T C579(0.95)  LDD1546  [33]
 LDCM0308  AC46 HEK-293T C579(1.03)  LDD1547  [33]
 LDCM0309  AC47 HEK-293T C579(0.95)  LDD1548  [33]
 LDCM0310  AC48 HEK-293T C579(0.92)  LDD1549  [33]
 LDCM0311  AC49 HEK-293T C579(0.99); C599(1.34)  LDD1550  [33]
 LDCM0312  AC5 HEK-293T C579(0.95)  LDD1551  [33]
 LDCM0313  AC50 HEK-293T C579(0.94)  LDD1552  [33]
 LDCM0314  AC51 HEK-293T C579(1.09)  LDD1553  [33]
 LDCM0315  AC52 HEK-293T C579(0.98)  LDD1554  [33]
 LDCM0316  AC53 HEK-293T C579(0.97)  LDD1555  [33]
 LDCM0317  AC54 HEK-293T C579(0.99)  LDD1556  [33]
 LDCM0318  AC55 HEK-293T C579(0.91)  LDD1557  [33]
 LDCM0319  AC56 HEK-293T C579(0.82)  LDD1558  [33]
 LDCM0320  AC57 HEK-293T C579(1.02); C599(1.70)  LDD1559  [33]
 LDCM0321  AC58 HEK-293T C579(1.05)  LDD1560  [33]
 LDCM0322  AC59 HEK-293T C579(1.08)  LDD1561  [33]
 LDCM0323  AC6 HEK-293T C579(0.99)  LDD1562  [33]
 LDCM0324  AC60 HEK-293T C579(0.99)  LDD1563  [33]
 LDCM0325  AC61 HEK-293T C579(1.00)  LDD1564  [33]
 LDCM0326  AC62 HEK-293T C579(1.03)  LDD1565  [33]
 LDCM0327  AC63 HEK-293T C579(0.95)  LDD1566  [33]
 LDCM0328  AC64 HEK-293T C579(0.89)  LDD1567  [33]
 LDCM0334  AC7 HEK-293T C579(0.93)  LDD1568  [33]
 LDCM0345  AC8 HEK-293T C579(0.96)  LDD1569  [33]
 LDCM0248  AKOS034007472 HEK-293T C579(1.04)  LDD1511  [33]
 LDCM0356  AKOS034007680 HEK-293T C579(0.95); C599(1.01)  LDD1570  [33]
 LDCM0275  AKOS034007705 HEK-293T C579(0.91)  LDD1514  [33]
 LDCM0156  Aniline NCI-H1299 12.22  LDD0403  [1]
 LDCM0630  CCW28-3 231MFP C579(1.46)  LDD2214  [34]
 LDCM0632  CL-Sc Hep-G2 C436(0.88)  LDD2227  [20]
 LDCM0367  CL1 HEK-293T C579(1.00)  LDD1571  [33]
 LDCM0368  CL10 HEK-293T C579(1.36)  LDD1572  [33]
 LDCM0369  CL100 HEK-293T C579(1.07)  LDD1573  [33]
 LDCM0370  CL101 HEK-293T C579(0.89)  LDD1574  [33]
 LDCM0371  CL102 HEK-293T C579(0.96)  LDD1575  [33]
 LDCM0372  CL103 HEK-293T C579(0.95)  LDD1576  [33]
 LDCM0373  CL104 HEK-293T C579(1.01)  LDD1577  [33]
 LDCM0374  CL105 HEK-293T C579(0.94)  LDD1578  [33]
 LDCM0375  CL106 HEK-293T C579(0.96)  LDD1579  [33]
 LDCM0376  CL107 HEK-293T C579(0.91)  LDD1580  [33]
 LDCM0377  CL108 HEK-293T C579(1.06)  LDD1581  [33]
 LDCM0378  CL109 HEK-293T C579(0.92)  LDD1582  [33]
 LDCM0379  CL11 HEK-293T C579(0.74)  LDD1583  [33]
 LDCM0380  CL110 HEK-293T C579(0.98)  LDD1584  [33]
 LDCM0381  CL111 HEK-293T C579(1.02)  LDD1585  [33]
 LDCM0382  CL112 HEK-293T C579(1.02)  LDD1586  [33]
 LDCM0383  CL113 HEK-293T C579(0.90)  LDD1587  [33]
 LDCM0384  CL114 HEK-293T C579(1.02)  LDD1588  [33]
 LDCM0385  CL115 HEK-293T C579(1.06)  LDD1589  [33]
 LDCM0386  CL116 HEK-293T C579(1.04)  LDD1590  [33]
 LDCM0387  CL117 HEK-293T C579(0.97)  LDD1591  [33]
 LDCM0388  CL118 HEK-293T C579(1.02)  LDD1592  [33]
 LDCM0389  CL119 HEK-293T C579(1.01)  LDD1593  [33]
 LDCM0390  CL12 HEK-293T C579(0.88)  LDD1594  [33]
 LDCM0391  CL120 HEK-293T C579(1.06)  LDD1595  [33]
 LDCM0392  CL121 HEK-293T C579(0.93)  LDD1596  [33]
 LDCM0393  CL122 HEK-293T C579(0.94)  LDD1597  [33]
 LDCM0394  CL123 HEK-293T C579(1.00)  LDD1598  [33]
 LDCM0395  CL124 HEK-293T C579(1.02)  LDD1599  [33]
 LDCM0396  CL125 HEK-293T C579(1.08)  LDD1600  [33]
 LDCM0397  CL126 HEK-293T C579(1.03)  LDD1601  [33]
 LDCM0398  CL127 HEK-293T C579(1.05)  LDD1602  [33]
 LDCM0399  CL128 HEK-293T C579(1.10)  LDD1603  [33]
 LDCM0400  CL13 HEK-293T C579(0.90)  LDD1604  [33]
 LDCM0401  CL14 HEK-293T C579(0.98)  LDD1605  [33]
 LDCM0402  CL15 HEK-293T C579(0.91)  LDD1606  [33]
 LDCM0403  CL16 HEK-293T C579(1.06)  LDD1607  [33]
 LDCM0404  CL17 HEK-293T C579(0.95); C599(1.19)  LDD1608  [33]
 LDCM0405  CL18 HEK-293T C579(0.94)  LDD1609  [33]
 LDCM0406  CL19 HEK-293T C579(1.02)  LDD1610  [33]
 LDCM0407  CL2 HEK-293T C579(1.11)  LDD1611  [33]
 LDCM0408  CL20 HEK-293T C579(0.94)  LDD1612  [33]
 LDCM0409  CL21 HEK-293T C579(0.93)  LDD1613  [33]
 LDCM0410  CL22 HEK-293T C579(0.99)  LDD1614  [33]
 LDCM0411  CL23 HEK-293T C579(0.65)  LDD1615  [33]
 LDCM0412  CL24 HEK-293T C579(0.93)  LDD1616  [33]
 LDCM0413  CL25 HEK-293T C579(0.93)  LDD1617  [33]
 LDCM0414  CL26 HEK-293T C579(0.97)  LDD1618  [33]
 LDCM0415  CL27 HEK-293T C579(0.94)  LDD1619  [33]
 LDCM0416  CL28 HEK-293T C579(1.02)  LDD1620  [33]
 LDCM0417  CL29 HEK-293T C579(0.91); C599(0.97)  LDD1621  [33]
 LDCM0418  CL3 HEK-293T C579(0.98)  LDD1622  [33]
 LDCM0419  CL30 HEK-293T C579(0.99)  LDD1623  [33]
 LDCM0420  CL31 HEK-293T C579(1.05)  LDD1624  [33]
 LDCM0421  CL32 HEK-293T C579(0.86)  LDD1625  [33]
 LDCM0422  CL33 HEK-293T C579(0.96)  LDD1626  [33]
 LDCM0423  CL34 HEK-293T C579(1.03)  LDD1627  [33]
 LDCM0424  CL35 HEK-293T C579(0.62)  LDD1628  [33]
 LDCM0425  CL36 HEK-293T C579(1.03)  LDD1629  [33]
 LDCM0426  CL37 HEK-293T C579(0.97)  LDD1630  [33]
 LDCM0428  CL39 HEK-293T C579(1.00)  LDD1632  [33]
 LDCM0429  CL4 HEK-293T C579(1.12)  LDD1633  [33]
 LDCM0430  CL40 HEK-293T C579(1.07)  LDD1634  [33]
 LDCM0431  CL41 HEK-293T C579(0.91); C599(1.24)  LDD1635  [33]
 LDCM0432  CL42 HEK-293T C579(1.00)  LDD1636  [33]
 LDCM0433  CL43 HEK-293T C579(1.04)  LDD1637  [33]
 LDCM0434  CL44 HEK-293T C579(0.97)  LDD1638  [33]
 LDCM0435  CL45 HEK-293T C579(1.05)  LDD1639  [33]
 LDCM0436  CL46 HEK-293T C579(1.05)  LDD1640  [33]
 LDCM0437  CL47 HEK-293T C579(0.70)  LDD1641  [33]
 LDCM0438  CL48 HEK-293T C579(0.93)  LDD1642  [33]
 LDCM0439  CL49 HEK-293T C579(0.95)  LDD1643  [33]
 LDCM0440  CL5 HEK-293T C579(1.01); C599(1.41)  LDD1644  [33]
 LDCM0441  CL50 HEK-293T C579(0.98)  LDD1645  [33]
 LDCM0443  CL52 HEK-293T C579(1.00)  LDD1646  [33]
 LDCM0444  CL53 HEK-293T C579(1.01); C599(1.51)  LDD1647  [33]
 LDCM0445  CL54 HEK-293T C579(0.98)  LDD1648  [33]
 LDCM0446  CL55 HEK-293T C579(0.96)  LDD1649  [33]
 LDCM0447  CL56 HEK-293T C579(0.93)  LDD1650  [33]
 LDCM0448  CL57 HEK-293T C579(0.98)  LDD1651  [33]
 LDCM0449  CL58 HEK-293T C579(0.91)  LDD1652  [33]
 LDCM0450  CL59 HEK-293T C579(0.69)  LDD1653  [33]
 LDCM0451  CL6 HEK-293T C579(0.93)  LDD1654  [33]
 LDCM0452  CL60 HEK-293T C579(0.81)  LDD1655  [33]
 LDCM0453  CL61 HEK-293T C579(1.01)  LDD1656  [33]
 LDCM0454  CL62 HEK-293T C579(1.06)  LDD1657  [33]
 LDCM0455  CL63 HEK-293T C579(0.94)  LDD1658  [33]
 LDCM0456  CL64 HEK-293T C579(0.96)  LDD1659  [33]
 LDCM0457  CL65 HEK-293T C579(0.94); C599(1.28)  LDD1660  [33]
 LDCM0458  CL66 HEK-293T C579(0.92)  LDD1661  [33]
 LDCM0459  CL67 HEK-293T C579(1.01)  LDD1662  [33]
 LDCM0460  CL68 HEK-293T C579(0.93)  LDD1663  [33]
 LDCM0461  CL69 HEK-293T C579(0.95)  LDD1664  [33]
 LDCM0462  CL7 HEK-293T C579(1.04)  LDD1665  [33]
 LDCM0463  CL70 HEK-293T C579(0.98)  LDD1666  [33]
 LDCM0464  CL71 HEK-293T C579(0.73)  LDD1667  [33]
 LDCM0465  CL72 HEK-293T C579(0.80)  LDD1668  [33]
 LDCM0466  CL73 HEK-293T C579(0.89)  LDD1669  [33]
 LDCM0467  CL74 HEK-293T C579(0.97)  LDD1670  [33]
 LDCM0469  CL76 HEK-293T C579(0.94)  LDD1672  [33]
 LDCM0470  CL77 HEK-293T C579(1.00); C599(1.45)  LDD1673  [33]
 LDCM0471  CL78 HEK-293T C579(0.87)  LDD1674  [33]
 LDCM0472  CL79 HEK-293T C579(0.92)  LDD1675  [33]
 LDCM0473  CL8 HEK-293T C579(0.80)  LDD1676  [33]
 LDCM0474  CL80 HEK-293T C579(0.93)  LDD1677  [33]
 LDCM0475  CL81 HEK-293T C579(0.95)  LDD1678  [33]
 LDCM0476  CL82 HEK-293T C579(0.95)  LDD1679  [33]
 LDCM0477  CL83 HEK-293T C579(0.73)  LDD1680  [33]
 LDCM0478  CL84 HEK-293T C579(0.97)  LDD1681  [33]
 LDCM0479  CL85 HEK-293T C579(1.12)  LDD1682  [33]
 LDCM0480  CL86 HEK-293T C579(1.04)  LDD1683  [33]
 LDCM0481  CL87 HEK-293T C579(1.02)  LDD1684  [33]
 LDCM0482  CL88 HEK-293T C579(1.03)  LDD1685  [33]
 LDCM0483  CL89 HEK-293T C579(1.02); C599(1.14)  LDD1686  [33]
 LDCM0484  CL9 HEK-293T C579(0.96)  LDD1687  [33]
 LDCM0485  CL90 HEK-293T C579(1.19)  LDD1688  [33]
 LDCM0486  CL91 HEK-293T C579(0.98)  LDD1689  [33]
 LDCM0487  CL92 HEK-293T C579(0.94)  LDD1690  [33]
 LDCM0488  CL93 HEK-293T C579(0.89)  LDD1691  [33]
 LDCM0489  CL94 HEK-293T C579(1.03)  LDD1692  [33]
 LDCM0490  CL95 HEK-293T C579(0.80)  LDD1693  [33]
 LDCM0491  CL96 HEK-293T C579(0.96)  LDD1694  [33]
 LDCM0492  CL97 HEK-293T C579(0.95)  LDD1695  [33]
 LDCM0493  CL98 HEK-293T C579(1.05)  LDD1696  [33]
 LDCM0494  CL99 HEK-293T C579(1.25)  LDD1697  [33]
 LDCM0189  Compound 16 HEK-293T 15.75  LDD0492  [27]
 LDCM0185  Compound 17 HEK-293T 19.23  LDD0504  [27]
 LDCM0182  Compound 18 HEK-293T 7.74  LDD0501  [27]
 LDCM0184  Compound 20 HEK-293T 10.53  LDD0503  [27]
 LDCM0191  Compound 21 HEK-293T 10.00  LDD0493  [27]
 LDCM0186  Compound 31 HEK-293T 10.36  LDD0506  [27]
 LDCM0187  Compound 32 HEK-293T 16.95  LDD0507  [27]
 LDCM0188  Compound 33 HEK-293T 9.71  LDD0505  [27]
 LDCM0190  Compound 34 HEK-293T 17.09  LDD0497  [27]
 LDCM0192  Compound 35 HEK-293T 7.41  LDD0491  [27]
 LDCM0193  Compound 36 HEK-293T 6.39  LDD0494  [27]
 LDCM0194  Compound 37 HEK-293T 10.42  LDD0498  [27]
 LDCM0195  Compound 38 HEK-293T 7.43  LDD0499  [27]
 LDCM0196  Compound 39 HEK-293T 10.31  LDD0496  [27]
 LDCM0197  Compound 40 HEK-293T 9.22  LDD0495  [27]
 LDCM0181  Compound 41 HEK-293T 5.91  LDD0502  [27]
 LDCM0097  Dasatinib K562 7.00  LDD0270  [6]
 LDCM0495  E2913 HEK-293T C579(1.03)  LDD1698  [33]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C560(2.91); C436(0.52)  LDD1702  [4]
 LDCM0175  Ethacrynic acid HeLa N.A.  LDD0440  [12]
 LDCM0625  F8 Ramos C229(0.48)  LDD2187  [35]
 LDCM0573  Fragment11 MDA-MB-231 C436(0.50)  LDD1467  [9]
 LDCM0574  Fragment12 MDA-MB-231 C436(1.42)  LDD1468  [9]
 LDCM0575  Fragment13 MDA-MB-231 C436(1.03)  LDD1469  [9]
 LDCM0576  Fragment14 MDA-MB-231 C436(0.58)  LDD1471  [9]
 LDCM0587  Fragment29 Ramos C436(1.31)  LDD1476  [9]
 LDCM0468  Fragment33 HEK-293T C579(1.01)  LDD1671  [33]
 LDCM0599  Fragment41 MDA-MB-231 C436(4.54)  LDD1481  [9]
 LDCM0427  Fragment51 HEK-293T C579(0.89)  LDD1631  [33]
 LDCM0616  Fragment61 Jurkat _(11.51)  LDD1489  [9]
 LDCM0615  Fragment63-R Jurkat _(4.37)  LDD1487  [9]
 LDCM0569  Fragment7 Jurkat _(4.47)  LDD1485  [9]
 LDCM0571  Fragment9 MDA-MB-231 C436(2.10)  LDD1463  [9]
 LDCM0116  HHS-0101 DM93 Y488(0.88)  LDD0264  [14]
 LDCM0117  HHS-0201 DM93 Y488(1.17)  LDD0265  [14]
 LDCM0118  HHS-0301 DM93 Y488(1.12)  LDD0266  [14]
 LDCM0119  HHS-0401 DM93 Y488(1.78)  LDD0267  [14]
 LDCM0120  HHS-0701 DM93 Y488(1.06)  LDD0268  [14]
 LDCM0015  HNE MDA-MB-231 C579(1.31)  LDD0346  [35]
 LDCM0073  Kambe_cp3 PC-3 6.24  LDD0127  [30]
 LDCM0022  KB02 T cell C436(19.28)  LDD1703  [36]
 LDCM0023  KB03 Jurkat C229(5.81); C560(9.58)  LDD0209  [13]
 LDCM0024  KB05 G361 C234(2.30)  LDD3311  [37]
 LDCM0506  Nucleophilic fragment 16a MDA-MB-231 C560(1.03)  LDD2099  [4]
 LDCM0514  Nucleophilic fragment 20a MDA-MB-231 C560(1.09)  LDD2107  [4]
 LDCM0530  Nucleophilic fragment 28a MDA-MB-231 C560(0.99)  LDD2123  [4]
 LDCM0532  Nucleophilic fragment 29a MDA-MB-231 C560(1.14)  LDD2125  [4]
 LDCM0543  Nucleophilic fragment 38 MDA-MB-231 C560(1.26)  LDD2136  [4]
 LDCM0001  Panyain_cp1 HEK-293T 2.62  LDD0040  [10]
 LDCM0137  SR-4995 HEK-293T 3.21  LDD0331  [29]
 LDCM0003  Sulforaphane MDA-MB-231 2.33  LDD0160  [8]
 LDCM0021  THZ1 HeLa S3 C579(1.18)  LDD0460  [7]
 LDCM0111  W14 Hep-G2 C436(14.34)  LDD0238  [24]
 LDCM0112  W16 Hep-G2 C436(1.63)  LDD0239  [24]
 LDCM0113  W17 Hep-G2 C436(7.19)  LDD0240  [24]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Casein kinase II subunit beta (CSNK2B) Casein kinase 2 subunit beta family P67870
Mitogen-activated protein kinase 1 (MAPK1) CMGC Ser/Thr protein kinase family P28482
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Heat shock protein HSP 90-beta (HSP90AB1) Heat shock protein 90 family P08238
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Guanine nucleotide-binding protein G(o) subunit alpha (GNAO1) G-alpha family P09471
Sprouty-related, EVH1 domain-containing protein 2 (SPRED2) . Q7Z698

The Drug(s) Related To This Target

Approved
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Acetylsalicylic Acid Small molecular drug DB00945
Fostamatinib Small molecular drug DB12010
Preclinical
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Bi-d1870 Small molecular drug D02VBF
Investigative
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Bix 02565 Small molecular drug D0U3NI
Pmid22564207c25b Small molecular drug D09AID
Pmid22765894c8h Small molecular drug D0C2GE
Patented
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Indole-based Analog 14 Small molecular drug D01IOH
Pmid27410995-compound-figure3j Small molecular drug D0O6TG
Pyrrolo[2,3-d]Pyrimidine Derivative 35 Small molecular drug D0X8YV

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
3 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
4 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
5 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
6 Streamlined Target Deconvolution Approach Utilizing a Single Photoreactive Chloroalkane Capture Tag. ACS Chem Biol. 2021 Feb 19;16(2):404-413. doi: 10.1021/acschembio.0c00987. Epub 2021 Feb 5.
7 A Chemoproteomic Strategy for Direct and Proteome-Wide Covalent Inhibitor Target-Site Identification. J Am Chem Soc. 2019 Jan 9;141(1):191-203. doi: 10.1021/jacs.8b07911. Epub 2018 Dec 20.
8 Competition-based, quantitative chemical proteomics in breast cancer cells identifies new target profiles for sulforaphane. Chem Commun (Camb). 2017 May 4;53(37):5182-5185. doi: 10.1039/c6cc08797c.
Mass spectrometry data entry: PXD006279
9 Proteome-wide covalent ligand discovery in native biological systems. Nature. 2016 Jun 23;534(7608):570-4. doi: 10.1038/nature18002. Epub 2016 Jun 15.
10 Correction to "Discovery of a Potent and Selective Covalent Inhibitor and Activity-Based Probe for the Deubiquitylating Enzyme UCHL1, with Antifibrotic Activity". J Am Chem Soc. 2020 Sep 2;142(35):15199. doi: 10.1021/jacs.0c08385. Epub 2020 Aug 19.
Mass spectrometry data entry: PXD015825
11 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
12 Chemoproteomic Profiling Reveals Ethacrynic Acid Targets Adenine Nucleotide Translocases to Impair Mitochondrial Function. Mol Pharm. 2018 Jun 4;15(6):2413-2422. doi: 10.1021/acs.molpharmaceut.8b00250. Epub 2018 May 15.
13 Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.
14 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
15 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
16 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
17 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
18 SP3-Enabled Rapid and High Coverage Chemoproteomic Identification of Cell-State-Dependent Redox-Sensitive Cysteines. Mol Cell Proteomics. 2022 Apr;21(4):100218. doi: 10.1016/j.mcpro.2022.100218. Epub 2022 Feb 25.
Mass spectrometry data entry: PXD029500 , PXD031647
19 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
20 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
21 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
22 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
23 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
24 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
25 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
26 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
27 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
28 Pharmacological Targeting of Vacuolar H(+)-ATPase via Subunit V1G Combats Multidrug-Resistant Cancer. Cell Chem Biol. 2020 Nov 19;27(11):1359-1370.e8. doi: 10.1016/j.chembiol.2020.06.011. Epub 2020 Jul 9.
29 Mapping Protein Targets of Bioactive Small Molecules Using Lipid-Based Chemical Proteomics. ACS Chem Biol. 2017 Oct 20;12(10):2671-2681. doi: 10.1021/acschembio.7b00581. Epub 2017 Sep 20.
Mass spectrometry data entry: PXD007570
30 Mapping the protein interaction landscape for fully functionalized small-molecule probes in human cells. J Am Chem Soc. 2014 Jul 30;136(30):10777-82. doi: 10.1021/ja505517t. Epub 2014 Jul 21.
31 Cell-based proteome profiling of potential dasatinib targets by use of affinity-based probes. J Am Chem Soc. 2012 Feb 15;134(6):3001-14. doi: 10.1021/ja208518u. Epub 2012 Feb 1.
32 Proteome profiling reveals potential cellular targets of staurosporine using a clickable cell-permeable probe. Chem Commun (Camb). 2011 Oct 28;47(40):11306-8. doi: 10.1039/c1cc14824a. Epub 2011 Sep 16.
33 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
34 Covalent Ligand Screening Uncovers a RNF4 E3 Ligase Recruiter for Targeted Protein Degradation Applications. ACS Chem Biol. 2019 Nov 15;14(11):2430-2440. doi: 10.1021/acschembio.8b01083. Epub 2019 May 13.
35 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
36 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.
37 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840