Details of the Target
General Information of Target
| Target ID | LDTP14717 | |||||
|---|---|---|---|---|---|---|
| Target Name | ATP synthase subunit e, mitochondrial (ATP5ME) | |||||
| Gene Name | ATP5ME | |||||
| Gene ID | 521 | |||||
| Synonyms |
ATP5I; ATP5K; ATP synthase subunit e, mitochondrial; ATPase subunit e; ATP synthase membrane subunit e) [Cleaved into: ATP synthase subunit e, mitochondrial, N-terminally processed] |
|||||
| 3D Structure | ||||||
| Sequence |
MLQSIIKNIWIPMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
ATPase e subunit family
|
|||||
| Subcellular location |
Mitochondrion
|
|||||
| Function |
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TH211 Probe Info |
![]() |
Y32(20.00); Y30(18.34) | LDD0260 | [1] | |
|
C-Sul Probe Info |
![]() |
5.93 | LDD0066 | [2] | |
|
TH216 Probe Info |
![]() |
Y32(15.34) | LDD0259 | [1] | |
|
STPyne Probe Info |
![]() |
K34(4.17); K50(10.00); K55(7.81) | LDD0277 | [3] | |
|
AZ-9 Probe Info |
![]() |
E60(1.16) | LDD2208 | [4] | |
|
ONAyne Probe Info |
![]() |
K34(0.00); K48(0.00) | LDD0273 | [3] | |
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [5] | |
PAL-AfBPP Probe
The Interaction Atlas With This Target
References




































