Details of the Target
General Information of Target
Target ID | LDTP06501 | |||||
---|---|---|---|---|---|---|
Target Name | Ras-related protein Rab-11B (RAB11B) | |||||
Gene Name | RAB11B | |||||
Gene ID | 9230 | |||||
Synonyms |
YPT3; Ras-related protein Rab-11B; EC 3.6.5.2; GTP-binding protein YPT3 |
|||||
3D Structure | ||||||
Sequence |
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Small GTPase superfamily, Rab family
|
|||||
Subcellular location |
Recycling endosome membrane
|
|||||
Function |
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. The small Rab GTPase RAB11B plays a role in endocytic recycling, regulating apical recycling of several transmembrane proteins including cystic fibrosis transmembrane conductance regulator/CFTR, epithelial sodium channel/ENaC, potassium voltage-gated channel, and voltage-dependent L-type calcium channel. May also regulate constitutive and regulated secretion, like insulin granule exocytosis. Required for melanosome transport and release from melanocytes. Also regulates V-ATPase intracellular transport in response to extracellular acidosis. Promotes Rabin8/RAB3IP preciliary vesicular trafficking to mother centriole by forming a ciliary targeting complex containing Rab11, ASAP1, Rabin8/RAB3IP, RAB11FIP3 and ARF4, thereby regulating ciliogenesis initiation (Probable). On the contrary, upon LPAR1 receptor signaling pathway activation, interaction with phosphorylated WDR44 prevents Rab11-RAB3IP-RAB11FIP3 complex formation and cilia growth (Probable).
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
FBPP2 Probe Info |
![]() |
4.73 | LDD0318 | [1] | |
TH211 Probe Info |
![]() |
Y91(7.45) | LDD0260 | [2] | |
ONAyne Probe Info |
![]() |
K179(3.12); K58(1.08) | LDD0274 | [3] | |
STPyne Probe Info |
![]() |
K179(9.65) | LDD0277 | [3] | |
AZ-9 Probe Info |
![]() |
E39(1.05) | LDD2208 | [4] | |
OPA-S-S-alkyne Probe Info |
![]() |
K179(3.25) | LDD3494 | [5] | |
Alkylaryl probe 2 Probe Info |
![]() |
4.00 | LDD0392 | [6] | |
Jackson_14 Probe Info |
![]() |
2.08 | LDD0123 | [7] | |
Acrolein Probe Info |
![]() |
H96(0.00); H112(0.00) | LDD0217 | [8] | |
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [8] |
PAL-AfBPP Probe
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0108 | Chloroacetamide | HeLa | H96(0.00); H112(0.00) | LDD0222 | [8] |
LDCM0107 | IAA | HeLa | H112(0.00); H96(0.00) | LDD0221 | [8] |
LDCM0109 | NEM | HeLa | H112(0.00); H96(0.00) | LDD0223 | [8] |
LDCM0099 | Phenelzine | MDA-MB-231 | 4.00 | LDD0392 | [6] |
LDCM0016 | Ranjitkar_cp1 | MDA-MB-231 | 2.08 | LDD0123 | [7] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Proto-oncogene tyrosine-protein kinase Src (SRC) | Tyr protein kinase family | P12931 |
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Glutamate receptor 1 (GRIA1) | Glutamate-gated ion channel family | P42261 | |||
Wolframin (WFS1) | . | O76024 |
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Protein c-Fos (FOS) | BZIP family | P01100 |
Other
References