Details of the Target
General Information of Target
Target ID | LDTP15303 | |||||
---|---|---|---|---|---|---|
Target Name | Membrane progestin receptor alpha (PAQR7) | |||||
Gene Name | PAQR7 | |||||
Gene ID | 164091 | |||||
Synonyms |
MRPA; Membrane progestin receptor alpha; mPR alpha; Membrane progesterone P4 receptor alpha; Membrane progesterone receptor alpha; Progesterone and adipoQ receptor family member 7; Progestin and adipoQ receptor family member 7; Progestin and adipoQ receptor family member VII
|
|||||
3D Structure | ||||||
Sequence |
MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGLGLQDVPAELP
AATADLDLSHNALQRLRPGWLAPLFQLRALHLDHNELDALGRGVFVNASGLRLLDLSSNT LRALGRHDLDGLGALEKLLLFNNRLVHLDEHAFHGLRALSHLYLGCNELASFSFDHLHGL SATHLLTLDLSSNRLGHISVPELAALPAFLKNGLYLHNNPLPCDCRLYHLLQRWHQRGLS AVRDFAREYVCLAFKVPASRVRFFQHSRVFENCSSAPALGLERPEEHLYALVGRSLRLYC NTSVPAMRIAWVSPQQELLRAPGSRDGSIAVLADGSLAIGNVQEQHAGLFVCLATGPRLH HNQTHEYNVSVHFPRPEPEAFNTGFTTLLGCAVGLVLVLLYLFAPPCRCCRRACRCRRWP QTPSPLQELSAQSSVLSTTPPDAPSRKASVHKHVVFLEPGRRGLNGRVQLAVAEEFDLYN PGGLQLKAGSESASSIGSEGPMTT |
|||||
Target Bioclass |
GPCR
|
|||||
Family |
ADIPOR family
|
|||||
Subcellular location |
Cell membrane
|
|||||
Function |
Plasma membrane progesterone (P4) receptor coupled to G proteins. Seems to act through a G(i) mediated pathway. May be involved in oocyte maturation. Involved in neurosteroid inhibition of apoptosis. Also binds dehydroepiandrosterone (DHEA), pregnanolone, pregnenolone and allopregnanolone.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [1] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C017 Probe Info |
![]() |
10.27 | LDD1725 | [2] | |
C055 Probe Info |
![]() |
28.64 | LDD1752 | [2] | |
C056 Probe Info |
![]() |
31.12 | LDD1753 | [2] | |
C063 Probe Info |
![]() |
14.52 | LDD1760 | [2] | |
C067 Probe Info |
![]() |
9.99 | LDD1763 | [2] | |
C070 Probe Info |
![]() |
45.89 | LDD1766 | [2] | |
C071 Probe Info |
![]() |
31.34 | LDD1767 | [2] | |
C072 Probe Info |
![]() |
44.94 | LDD1768 | [2] | |
C153 Probe Info |
![]() |
29.65 | LDD1834 | [2] | |
C187 Probe Info |
![]() |
64.00 | LDD1865 | [2] | |
C191 Probe Info |
![]() |
46.21 | LDD1868 | [2] | |
C193 Probe Info |
![]() |
27.86 | LDD1869 | [2] | |
C201 Probe Info |
![]() |
27.86 | LDD1877 | [2] | |
C206 Probe Info |
![]() |
27.10 | LDD1881 | [2] | |
C222 Probe Info |
![]() |
4.92 | LDD1896 | [2] | |
C225 Probe Info |
![]() |
19.84 | LDD1898 | [2] | |
C226 Probe Info |
![]() |
12.38 | LDD1899 | [2] | |
C228 Probe Info |
![]() |
28.44 | LDD1901 | [2] | |
C355 Probe Info |
![]() |
54.19 | LDD2016 | [2] | |
C356 Probe Info |
![]() |
18.90 | LDD2017 | [2] | |
C357 Probe Info |
![]() |
10.63 | LDD2018 | [2] | |
C361 Probe Info |
![]() |
28.25 | LDD2022 | [2] | |
C383 Probe Info |
![]() |
13.83 | LDD2042 | [2] | |
C386 Probe Info |
![]() |
6.96 | LDD2045 | [2] | |
C389 Probe Info |
![]() |
6.59 | LDD2048 | [2] | |
OEA-DA Probe Info |
![]() |
20.00 | LDD0046 | [3] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Huntingtin (HTT) | Huntingtin family | P42858 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) | ERGIC family | Q9Y282 | |||
Protein FAM209A (FAM209A) | FAM209 family | Q5JX71 |
References