Details of the Target
General Information of Target
Target ID | LDTP13125 | |||||
---|---|---|---|---|---|---|
Target Name | Protein UXT (UXT) | |||||
Gene Name | UXT | |||||
Gene ID | 8409 | |||||
Synonyms |
Protein UXT; Androgen receptor trapped clone 27 protein; ART-27; Ubiquitously expressed transcript protein |
|||||
3D Structure | ||||||
Sequence |
MRRFLLLYATQQGQAKAIAEEICEQAVVHGFSADLHCISESDKYDLKTETAPLVVVVSTT
GTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKIIDKRLQELGA RHFYDTGHADDCVGLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASSRTDLV KSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIEDFESSLTRSVPPLSQASL NIPGLPPEYLQVHLQESLGQEESQVSVTSADPVFQVPISKAVQLTTNDAIKTTLLVELDI SNTDFSYQPGDAFSVICPNSDSEVQSLLQRLQLEDKREHCVLLKIKADTKKKGATLPQHI PAGCSLQFIFTWCLEIRAIPKKAFLRALVDYTSDSAEKRRLQELCSKQGAADYSRFVRDA CACLLDLLLAFPSCQPPLSLLLEHLPKLQPRPYSCASSSLFHPGKLHFVFNIVEFLSTAT TEVLRKGVCTGWLALLVASVLQPNIHASHEDSGKALAPKISISPRTTNSFHLPDDPSIPI IMVGPGTGIAPFIGFLQHREKLQEQHPDGNFGAMWLFFGCRHKDRDYLFRKELRHFLKHG ILTHLKVSFSRDAPVGEEEAPAKYVQDNIQLHGQQVARILLQENGHIYVCGDAKNMAKDV HDALVQIISKEVGVEKLEAMKTLATLKEEKRYLQDIWS |
|||||
Target Bioclass |
Other
|
|||||
Family |
UXT family
|
|||||
Subcellular location |
Cytoplasm; Nucleus
|
|||||
Function |
Involved in gene transcription regulation. Acts in concert with the corepressor URI1 to regulate androgen receptor AR-mediated transcription. Together with URI1, associates with chromatin to the NKX3-1 promoter region. Negatively regulates the transcriptional activity of the estrogen receptor ESR1 by inducing its translocation into the cytoplasm. May act as nuclear chaperone that facilitates the formation of the NF-kappa-B enhanceosome and thus positively regulates NF-kappa-B transcription activity. Potential component of mitochondrial-associated LRPPRC, a multidomain organizer that potentially integrates mitochondria and the microtubular cytoskeleton with chromosome remodeling. Increasing concentrations of UXT contributes to progressive aggregation of mitochondria and cell death potentially through its association with LRPPRC. Suppresses cell transformation and it might mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like MECOM.; [Isoform 1]: Plays a role in protecting cells against TNF-alpha-induced apoptosis by preventing the recruitment of FADD and caspase 8 to the apoptotic complex I, composed of TRADD, TRAF2 and RIPK1/RIP.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K16(10.00) | LDD0277 | [1] | |
HHS-482 Probe Info |
![]() |
Y20(0.77) | LDD0286 | [2] | |
HHS-475 Probe Info |
![]() |
Y20(0.92) | LDD0264 | [3] | |
HHS-465 Probe Info |
![]() |
Y20(10.00) | LDD2237 | [4] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0222 | [5] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C055 Probe Info |
![]() |
15.35 | LDD1752 | [6] | |
C106 Probe Info |
![]() |
22.94 | LDD1793 | [6] | |
C108 Probe Info |
![]() |
8.82 | LDD1795 | [6] | |
C134 Probe Info |
![]() |
22.16 | LDD1816 | [6] | |
C135 Probe Info |
![]() |
12.04 | LDD1817 | [6] | |
C139 Probe Info |
![]() |
12.30 | LDD1821 | [6] | |
C160 Probe Info |
![]() |
7.67 | LDD1840 | [6] | |
C161 Probe Info |
![]() |
17.39 | LDD1841 | [6] | |
C169 Probe Info |
![]() |
23.59 | LDD1849 | [6] | |
C210 Probe Info |
![]() |
59.30 | LDD1884 | [6] | |
C343 Probe Info |
![]() |
11.63 | LDD2005 | [6] | |
C348 Probe Info |
![]() |
13.45 | LDD2009 | [6] | |
C349 Probe Info |
![]() |
9.99 | LDD2010 | [6] | |
C350 Probe Info |
![]() |
34.54 | LDD2011 | [6] | |
C353 Probe Info |
![]() |
6.15 | LDD2014 | [6] | |
C354 Probe Info |
![]() |
10.70 | LDD2015 | [6] | |
C399 Probe Info |
![]() |
8.51 | LDD2058 | [6] | |
C403 Probe Info |
![]() |
22.16 | LDD2061 | [6] | |
C429 Probe Info |
![]() |
13.36 | LDD2084 | [6] | |
C431 Probe Info |
![]() |
26.17 | LDD2086 | [6] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [5] |
LDCM0116 | HHS-0101 | DM93 | Y20(0.92) | LDD0264 | [3] |
LDCM0117 | HHS-0201 | DM93 | Y20(0.72) | LDD0265 | [3] |
LDCM0118 | HHS-0301 | DM93 | Y20(0.99) | LDD0266 | [3] |
LDCM0119 | HHS-0401 | DM93 | Y20(0.77) | LDD0267 | [3] |
LDCM0120 | HHS-0701 | DM93 | Y20(1.05) | LDD0268 | [3] |
LDCM0124 | JWB142 | DM93 | Y20(0.77) | LDD0286 | [2] |
LDCM0125 | JWB146 | DM93 | Y20(0.80) | LDD0287 | [2] |
LDCM0126 | JWB150 | DM93 | Y20(2.40) | LDD0288 | [2] |
LDCM0127 | JWB152 | DM93 | Y20(1.94) | LDD0289 | [2] |
LDCM0128 | JWB198 | DM93 | Y20(0.33) | LDD0290 | [2] |
LDCM0129 | JWB202 | DM93 | Y20(0.19) | LDD0291 | [2] |
LDCM0130 | JWB211 | DM93 | Y20(0.58) | LDD0292 | [2] |
LDCM0109 | NEM | HeLa | N.A. | LDD0226 | [5] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Estrogen receptor (ESR1) | Nuclear hormone receptor family | P03372 | |||
Transcription factor p65 (RELA) | . | Q04206 |
Other
References