Details of the Target

General Information of Target

Target ID LDTP03499
Target Name Elongation factor 1-delta (EEF1D)
Gene Name EEF1D
Gene ID 1936
Synonyms
EF1D; Elongation factor 1-delta; EF-1-delta; Antigen NY-CO-4
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGASVILRDIARARENIQKS
LAGSSGPGASSGTSGDHGELVVRIASLEVENQSLRGVVQELQQAISKLEARLNVLEKSSP
GHRATAPQTQHVSPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLR
QYAEKKAKKPALVAKSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGI
RKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI
Target Bioclass
Other
Family
EF-1-beta/EF-1-delta family
Subcellular location
Nucleus
Function
[Isoform 1]: EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP, regenerating EF-1-alpha for another round of transfer of aminoacyl-tRNAs to the ribosome.; [Isoform 2]: Regulates induction of heat-shock-responsive genes through association with heat shock transcription factors and direct DNA-binding at heat shock promoter elements (HSE).
Uniprot ID
P29692
Ensemble ID
ENST00000317198.10
HGNC ID
HGNC:3211
ChEMBL ID
CHEMBL4295739

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 49 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
P2
 Probe Info  		10.00  LDD0449  [1]
P3
 Probe Info  		10.00  LDD0450  [1]
P8
 Probe Info  		10.00  LDD0451  [1]
A-EBA
 Probe Info  		3.31  LDD0215  [2]
ILS-1
 Probe Info  		2.16  LDD0415  [3]
CY-1
 Probe Info  		100.00  LDD0243  [4]
CY4
 Probe Info  		100.00  LDD0244  [4]
N1
 Probe Info  		100.00  LDD0242  [4]
C-Sul
 Probe Info  		2.59  LDD0066  [5]
TH211
 Probe Info  		Y26(10.00); Y18(8.23)  LDD0257  [6]
TH214
 Probe Info  		Y18(20.00); Y26(20.00)  LDD0258  [6]
TH216
 Probe Info  		Y18(20.00); Y26(12.71)  LDD0259  [6]
YN-1
 Probe Info  		100.00  LDD0444  [7]
AZ-9
 Probe Info  		E100(0.88); E90(0.94); D224(0.95); E79(0.92)  LDD2208  [8]
ONAyne
 Probe Info  		N.A.  LDD0273  [9]
Probe 1
 Probe Info  		Y18(270.12); Y26(41.10)  LDD3495  [10]
m-APA
 Probe Info  		7.32  LDD0403  [11]
DBIA
 Probe Info  		C613(0.96)  LDD3310  [12]
JZ128-DTB
 Probe Info  		N.A.  LDD0462  [13]
BTD
 Probe Info  		C247(0.63)  LDD2145  [14]
AHL-Pu-1
 Probe Info  		C217(2.33)  LDD0168  [15]
HHS-482
 Probe Info  		Y18(0.95); Y182(1.01); Y238(0.44); Y26(1.01)  LDD0285  [16]
HHS-475
 Probe Info  		Y18(0.81); Y26(0.82); Y182(0.86); Y238(3.92)  LDD0264  [17]
HHS-465
 Probe Info  		Y18(10.00)  LDD2237  [18]
5E-2FA
 Probe Info  		H131(0.00); H8(0.00); H269(0.00); H77(0.00)  LDD2235  [19]
4-Iodoacetamidophenylacetylene
 Probe Info  		C247(0.00); C217(0.00)  LDD0038  [20]
IA-alkyne
 Probe Info  		N.A.  LDD0032  [21]
IPIAA_H
 Probe Info  		N.A.  LDD0030  [22]
IPIAA_L
 Probe Info  		N.A.  LDD0031  [22]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [20]
ATP probe
 Probe Info  		K189(0.00); K59(0.00); K15(0.00); K107(0.00)  LDD0035  [23]
JW-RF-010
 Probe Info  		N.A.  LDD0026  [24]
WYneN
 Probe Info  		N.A.  LDD0021  [25]
1d-yne
 Probe Info  		N.A.  LDD0356  [26]
IPM
 Probe Info  		N.A.  LDD2156  [27]
NHS
 Probe Info  		K59(0.00); K117(0.00); K17(0.00)  LDD0010  [25]
OSF
 Probe Info  		N.A.  LDD0029  [28]
PF-06672131
 Probe Info  		N.A.  LDD0152  [29]
SF
 Probe Info  		Y18(0.00); K189(0.00); K117(0.00); K188(0.00)  LDD0028  [28]
STPyne
 Probe Info  		K117(0.00); K59(0.00)  LDD0009  [25]
Ox-W18
 Probe Info  		W12(0.00); W228(0.00)  LDD2175  [30]
1c-yne
 Probe Info  		K59(0.00); K15(0.00); K232(0.00); K10(0.00)  LDD0228  [26]
Acrolein
 Probe Info  		H77(0.00); C217(0.00)  LDD0217  [31]
Crotonaldehyde
 Probe Info  		N.A.  LDD0219  [31]
Methacrolein
 Probe Info  		H131(0.00); H77(0.00)  LDD0218  [31]
W1
 Probe Info  		N.A.  LDD0236  [32]
MPP-AC
 Probe Info  		N.A.  LDD0428  [33]
NAIA_5
 Probe Info  		N.A.  LDD2223  [34]
TER-AC
 Probe Info  		N.A.  LDD0426  [33]
PAL-AfBPP Probe
Click To Hide/Show 9 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C003
 Probe Info  		12.64  LDD1713  [35]
C301
 Probe Info  		5.10  LDD1970  [35]
C389
 Probe Info  		12.64  LDD2048  [35]
STS-2
 Probe Info  		N.A.  LDD0138  [36]
Probe 3
 Probe Info  		N.A.  LDD0195  [37]
Staurosporine capture compound
 Probe Info  		N.A.  LDD0083  [38]
DA-2
 Probe Info  		N.A.  LDD0070  [39]
OEA-DA
 Probe Info  		7.38  LDD0046  [40]
STS-1
 Probe Info  		N.A.  LDD0068  [41]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0101  23-cGAMP HeLa N.A.  LDD0195  [37]
 LDCM0025  4SU-RNA HEK-293T C217(2.33)  LDD0168  [15]
 LDCM0026  4SU-RNA+native RNA HEK-293T C217(2.44)  LDD0169  [15]
 LDCM0156  Aniline NCI-H1299 7.32  LDD0403  [11]
 LDCM0108  Chloroacetamide HeLa C217(0.00); H77(0.00); H131(0.00); C247(0.00)  LDD0222  [31]
 LDCM0116  HHS-0101 DM93 Y18(0.81); Y26(0.82); Y182(0.86); Y238(3.92)  LDD0264  [17]
 LDCM0117  HHS-0201 DM93 Y18(0.68); Y26(0.86); Y182(1.22); Y238(4.04)  LDD0265  [17]
 LDCM0118  HHS-0301 DM93 Y18(0.69); Y26(1.48); Y182(2.70); Y238(2.73)  LDD0266  [17]
 LDCM0119  HHS-0401 DM93 Y26(0.72); Y18(0.74); Y182(1.72); Y238(2.03)  LDD0267  [17]
 LDCM0120  HHS-0701 DM93 Y18(0.64); Y26(0.68); Y182(1.93); Y238(2.08)  LDD0268  [17]
 LDCM0107  IAA HeLa H77(0.00); H131(0.00); C247(0.00); C217(0.00)  LDD0221  [31]
 LDCM0123  JWB131 DM93 Y18(0.95); Y182(1.01); Y238(0.44); Y26(1.01)  LDD0285  [16]
 LDCM0124  JWB142 DM93 Y18(0.57); Y182(0.90); Y238(0.92); Y26(0.68)  LDD0286  [16]
 LDCM0125  JWB146 DM93 Y18(0.93); Y182(0.91); Y238(1.14); Y26(1.09)  LDD0287  [16]
 LDCM0126  JWB150 DM93 Y18(3.49); Y182(3.53); Y238(1.96); Y26(3.99)  LDD0288  [16]
 LDCM0127  JWB152 DM93 Y18(1.96); Y182(2.15); Y238(1.22); Y26(2.21)  LDD0289  [16]
 LDCM0128  JWB198 DM93 Y18(1.09); Y182(1.64); Y238(0.43); Y26(1.19)  LDD0290  [16]
 LDCM0129  JWB202 DM93 Y18(0.50); Y182(0.80); Y26(0.55)  LDD0291  [16]
 LDCM0130  JWB211 DM93 Y18(0.93); Y182(1.19); Y238(0.85); Y26(1.02)  LDD0292  [16]
 LDCM0179  JZ128 PC-3 N.A.  LDD0462  [13]
 LDCM0022  KB02 22RV1 C613(1.19)  LDD2243  [12]
 LDCM0023  KB03 22RV1 C613(1.02)  LDD2660  [12]
 LDCM0024  KB05 COLO792 C613(0.96)  LDD3310  [12]
 LDCM0109  NEM HeLa H131(0.00); H77(0.00)  LDD0223  [31]
 LDCM0551  Nucleophilic fragment 5b MDA-MB-231 C247(0.63)  LDD2145  [14]
 LDCM0131  RA190 MM1.R C247(1.26)  LDD0304  [42]
 LDCM0019  Staurosporine Hep-G2 N.A.  LDD0083  [38]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Superoxide dismutase [Cu-Zn] (SOD1) Cu-Zn superoxide dismutase family P00441
Endoplasmic reticulum resident protein 27 (ERP27) Protein disulfide isomerase family Q96DN0
E3 ubiquitin-protein ligase SIAH1 (SIAH1) SINA (Seven in absentia) family Q8IUQ4
Transporter and channel
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ubiquitin-like modifier-activating enzyme ATG7 (ATG7) ATG7 family O95352
Voltage-dependent anion-selective channel protein 2 (VDAC2) Eukaryotic mitochondrial porin family P45880
Huntingtin (HTT) Huntingtin family P42858
Lysosomal-associated transmembrane protein 4A (LAPTM4A) LAPTM4/LAPTM5 transporter family Q15012
Mitochondrial pyruvate carrier 2 (MPC2) Mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family O95563
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein max (MAX) MAX family P61244
ALX homeobox protein 1 (ALX1) Paired homeobox family Q15699
PHD finger protein 19 (PHF19) Polycomblike family Q5T6S3
Other
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Calmodulin-regulated spectrin-associated protein 2 (CAMSAP2) CAMSAP1 family Q08AD1
Inactive peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) FKBP6 family O75344
Translationally-controlled tumor protein (TPT1) TCTP family P13693
Zinc finger HIT domain-containing protein 1 (ZNHIT1) ZNHIT1 family O43257
Ankyrin repeat and BTB/POZ domain-containing protein 1 (ABTB1) . Q969K4
Elongation factor 1-gamma (EEF1G) . P26641
Melanoma-associated antigen B6 (MAGEB6) . Q8N7X4
Period circadian protein homolog 1 (PER1) . O15534
Rho GTPase-activating protein 21 (ARHGAP21) . Q5T5U3

References

1 Comparison of Different Competitive Proteome Profiling Approaches in Target Identification of Covalent Inhibitors. Chembiochem. 2022 Dec 16;23(24):e202200389. doi: 10.1002/cbic.202200389. Epub 2022 Nov 22.
2 2-Ethynylbenzaldehyde-Based, Lysine-Targeting Irreversible Covalent Inhibitors for Protein Kinases and Nonkinases. J Am Chem Soc. 2023 Feb 12. doi: 10.1021/jacs.2c11595. Online ahead of print.
Mass spectrometry data entry: PXD037665
3 A Chemical Proteomic Analysis of Illudin-Interacting Proteins. Chemistry. 2019 Sep 25;25(54):12644-12651. doi: 10.1002/chem.201902919. Epub 2019 Sep 3.
Mass spectrometry data entry: PXD014175
4 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.
5 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
6 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
7 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
8 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
9 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
10 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
11 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
12 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
13 A Chemoproteomic Strategy for Direct and Proteome-Wide Covalent Inhibitor Target-Site Identification. J Am Chem Soc. 2019 Jan 9;141(1):191-203. doi: 10.1021/jacs.8b07911. Epub 2018 Dec 20.
14 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
15 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
16 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
17 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
18 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
19 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
20 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
21 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
22 SP3-Enabled Rapid and High Coverage Chemoproteomic Identification of Cell-State-Dependent Redox-Sensitive Cysteines. Mol Cell Proteomics. 2022 Apr;21(4):100218. doi: 10.1016/j.mcpro.2022.100218. Epub 2022 Feb 25.
Mass spectrometry data entry: PXD029500 , PXD031647
23 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
24 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
25 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
26 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
27 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
28 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
29 Site-Specific Activity-Based Protein Profiling Using Phosphonate Handles. Mol Cell Proteomics. 2023 Jan;22(1):100455. doi: 10.1016/j.mcpro.2022.100455. Epub 2022 Nov 24.
Mass spectrometry data entry: PXD036569
30 Oxidative cyclization reagents reveal tryptophan cation- interactions. Nature. 2024 Mar;627(8004):680-687. doi: 10.1038/s41586-024-07140-6. Epub 2024 Mar 6.
Mass spectrometry data entry: PXD001377 , PXD005252
31 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
32 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
33 Differently Tagged Probes for Protein Profiling of Mitochondria. Chembiochem. 2019 May 2;20(9):1155-1160. doi: 10.1002/cbic.201800735. Epub 2019 Mar 26.
34 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
35 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
36 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.
37 A photoaffinity labeling strategy identified EF1A1 as a binding protein of cyclic dinucleotide 2'3'-cGAMP. Cell Chem Biol. 2022 Jan 20;29(1):133-144.e20. doi: 10.1016/j.chembiol.2021.08.006. Epub 2021 Sep 2.
38 Comprehensive identification of staurosporine-binding kinases in the hepatocyte cell line HepG2 using Capture Compound Mass Spectrometry (CCMS). J Proteome Res. 2010 Feb 5;9(2):806-17. doi: 10.1021/pr9007333.
39 Cell-based proteome profiling of potential dasatinib targets by use of affinity-based probes. J Am Chem Soc. 2012 Feb 15;134(6):3001-14. doi: 10.1021/ja208518u. Epub 2012 Feb 1.
40 Mapping Protein Targets of Bioactive Small Molecules Using Lipid-Based Chemical Proteomics. ACS Chem Biol. 2017 Oct 20;12(10):2671-2681. doi: 10.1021/acschembio.7b00581. Epub 2017 Sep 20.
Mass spectrometry data entry: PXD007570
41 Proteome profiling reveals potential cellular targets of staurosporine using a clickable cell-permeable probe. Chem Commun (Camb). 2011 Oct 28;47(40):11306-8. doi: 10.1039/c1cc14824a. Epub 2011 Sep 16.
42 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.