Details of the Target

General Information of Target

Target ID LDTP02165
Target Name Tropomyosin alpha-3 chain (TPM3)
Gene Name TPM3
Gene ID 7170
Synonyms
Tropomyosin alpha-3 chain; Gamma-tropomyosin; Tropomyosin-3; Tropomyosin-5; hTM5
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDK
YSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
ADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERT
EERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRA
EFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI
Target Bioclass
Other
Family
Tropomyosin family
Subcellular location
Cytoplasm, cytoskeleton
Function
Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments.
Uniprot ID
P06753
Ensemble ID
ENST00000302206.9
HGNC ID
HGNC:12012
ChEMBL ID
CHEMBL3804747

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
REH SNV: p.A263T .
RL952 Deletion: p.D138MfsTer34 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 23 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
P3
 Probe Info  		10.00  LDD0450  [2]
YN-1
 Probe Info  		100.00  LDD0444  [3]
ONAyne
 Probe Info  		K137(1.06); K150(0.78); K232(3.09)  LDD0274  [4]
STPyne
 Probe Info  		K137(6.94); K150(9.38); K169(3.29); K218(10.00)  LDD0277  [4]
OPA-S-S-alkyne
 Probe Info  		K119(3.65); K153(4.13); K234(5.08); K129(7.91)  LDD3494  [5]
Probe 1
 Probe Info  		Y163(48.39); Y222(101.52); Y262(29.49)  LDD3495  [6]
DBIA
 Probe Info  		C170(2.70)  LDD3313  [7]
BTD
 Probe Info  		C191(1.18)  LDD2089  [8]
DA-P3
 Probe Info  		5.27  LDD0181  [9]
HHS-482
 Probe Info  		Y163(0.98)  LDD0285  [10]
HHS-475
 Probe Info  		Y163(0.89)  LDD0264  [11]
Acrolein
 Probe Info  		N.A.  LDD0231  [12]
HHS-465
 Probe Info  		Y163(10.00)  LDD2237  [13]
5E-2FA
 Probe Info  		N.A.  LDD2235  [14]
ATP probe
 Probe Info  		K153(0.00); K162(0.00); K169(0.00); K141(0.00)  LDD0199  [15]
CY-1
 Probe Info  		N.A.  LDD0246  [16]
ATP probe
 Probe Info  		K129(0.00); K249(0.00); K119(0.00); K169(0.00)  LDD0035  [17]
AZ-9
 Probe Info  		D101(0.00); E98(0.00)  LDD0395  [18]
NHS
 Probe Info  		N.A.  LDD0010  [19]
SF
 Probe Info  		Y163(0.00); K162(0.00); K232(0.00); K113(0.00)  LDD0028  [20]
AOyne
 Probe Info  		15.00  LDD0443  [21]
TPP-AC
 Probe Info  		N.A.  LDD0427  [22]
PAL-AfBPP Probe
Click To Hide/Show 15 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C087
 Probe Info  		7.73  LDD1779  [23]
C187
 Probe Info  		17.15  LDD1865  [23]
C210
 Probe Info  		38.85  LDD1884  [23]
C313
 Probe Info  		12.21  LDD1980  [23]
C354
 Probe Info  		6.96  LDD2015  [23]
C362
 Probe Info  		26.72  LDD2023  [23]
C391
 Probe Info  		12.73  LDD2050  [23]
FFF probe12
 Probe Info  		15.51  LDD0473  [24]
FFF probe13
 Probe Info  		14.76  LDD0475  [24]
FFF probe14
 Probe Info  		12.37  LDD0477  [24]
FFF probe2
 Probe Info  		13.96  LDD0463  [24]
FFF probe4
 Probe Info  		20.00  LDD0466  [24]
FFF probe9
 Probe Info  		7.12  LDD0470  [24]
Diazir
 Probe Info  		E85(0.00); E97(0.00); E98(0.00)  LDD0011  [19]
OEA-DA
 Probe Info  		4.36  LDD0046  [25]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0539  3-(4-Isopropylpiperazin-1-yl)-3-oxopropanenitrile MDA-MB-231 C191(0.38)  LDD2132  [8]
 LDCM0156  Aniline NCI-H1299 11.50  LDD0403  [1]
 LDCM0498  BS-3668 MDA-MB-231 C191(0.98)  LDD2091  [8]
 LDCM0116  HHS-0101 DM93 Y163(0.89)  LDD0264  [11]
 LDCM0117  HHS-0201 DM93 Y163(0.77)  LDD0265  [11]
 LDCM0118  HHS-0301 DM93 Y163(0.89)  LDD0266  [11]
 LDCM0119  HHS-0401 DM93 Y163(0.86)  LDD0267  [11]
 LDCM0120  HHS-0701 DM93 Y163(0.74)  LDD0268  [11]
 LDCM0123  JWB131 DM93 Y163(0.98)  LDD0285  [10]
 LDCM0124  JWB142 DM93 Y163(0.88)  LDD0286  [10]
 LDCM0125  JWB146 DM93 Y163(1.04)  LDD0287  [10]
 LDCM0126  JWB150 DM93 Y163(4.39)  LDD0288  [10]
 LDCM0127  JWB152 DM93 Y163(2.61)  LDD0289  [10]
 LDCM0128  JWB198 DM93 Y163(1.92)  LDD0290  [10]
 LDCM0129  JWB202 DM93 Y163(0.79)  LDD0291  [10]
 LDCM0130  JWB211 DM93 Y163(1.14)  LDD0292  [10]
 LDCM0022  KB02 A101D C170(2.83)  LDD2250  [7]
 LDCM0023  KB03 A101D C170(2.94)  LDD2667  [7]
 LDCM0024  KB05 Hs 936.T C170(2.70)  LDD3313  [7]
 LDCM0109  NEM HeLa N.A.  LDD0231  [12]
 LDCM0496  Nucleophilic fragment 11a MDA-MB-231 C191(1.18)  LDD2089  [8]
 LDCM0497  Nucleophilic fragment 11b MDA-MB-231 C191(0.90)  LDD2090  [8]
 LDCM0522  Nucleophilic fragment 24a MDA-MB-231 C191(0.61)  LDD2115  [8]
 LDCM0527  Nucleophilic fragment 26b MDA-MB-231 C191(0.82)  LDD2120  [8]
 LDCM0535  Nucleophilic fragment 30b MDA-MB-231 C191(0.79)  LDD2128  [8]
 LDCM0551  Nucleophilic fragment 5b MDA-MB-231 C191(0.43)  LDD2145  [8]
 LDCM0553  Nucleophilic fragment 6b MDA-MB-231 C191(1.33)  LDD2147  [8]
 LDCM0554  Nucleophilic fragment 7a MDA-MB-231 C191(0.69)  LDD2148  [8]
 LDCM0029  Quercetin HEK-293T 5.27  LDD0181  [9]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
26S proteasome regulatory subunit 8 (PSMC5) AAA ATPase family P62195
Beta-secretase 2 (BACE2) Peptidase A1 family Q9Y5Z0
Kallikrein-6 (KLK6) Peptidase S1 family Q92876
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nucleoporin p54 (NUP54) NUP54 family Q7Z3B4
SNARE-associated protein Snapin (SNAPIN) SNAPIN family O95295
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Heat shock factor protein 2 (HSF2) HSF family Q03933
THAP domain-containing protein 1 (THAP1) THAP1 family Q9NVV9
THAP domain-containing protein 7 (THAP7) . Q9BT49
Other
Click To Hide/Show 17 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ataxin-1 (ATXN1) ATXN1 family P54253
Caveolae-associated protein 3 (CAVIN3) CAVIN family Q969G5
Protein FAM9C (FAM9C) FAM9 family Q8IZT9
Interferon-induced protein with tetratricopeptide repeats 3 (IFIT3) IFIT family O14879
KxDL motif-containing protein 1 (KXD1) KXD1 family Q9BQD3
Lebercilin-like protein (LCA5L) LCA5 family O95447
Mitotic spindle assembly checkpoint protein MAD1 (MAD1L1) MAD1 family Q9Y6D9
Protein Mis18-beta (OIP5) Mis18 family O43482
Synaptonemal complex central element protein 1 (SYCE1) SYCE family Q8N0S2
Tropomyosin alpha-4 chain (TPM4) Tropomyosin family P67936
Troponin I, slow skeletal muscle (TNNI1) Troponin I family P19237
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
Vacuolar protein sorting-associated protein 52 homolog (VPS52) VPS52 family Q8N1B4
Leucine rich adaptor protein 1 (LURAP1) . Q96LR2
TCF3 fusion partner (TFPT) . P0C1Z6
Testis-specific serine kinase substrate (TSKS) . Q9UJT2
TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 (TAB2) . Q9NYJ8

The Drug(s) Related To This Target

Investigative
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Phenethyl Isothiocyanate Small molecular drug DB12695

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Comparison of Different Competitive Proteome Profiling Approaches in Target Identification of Covalent Inhibitors. Chembiochem. 2022 Dec 16;23(24):e202200389. doi: 10.1002/cbic.202200389. Epub 2022 Nov 22.
3 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
4 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
5 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
6 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
7 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
8 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
9 A chemical probe unravels the reactive proteome of health-associated catechols. Chem Sci. 2023 Jul 22;14(32):8635-8643. doi: 10.1039/d3sc00888f. eCollection 2023 Aug 16.
Mass spectrometry data entry: PXD043348
10 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
11 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
12 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
13 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
14 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
15 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
16 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.
17 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
18 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
19 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
20 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
21 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
22 Differently Tagged Probes for Protein Profiling of Mitochondria. Chembiochem. 2019 May 2;20(9):1155-1160. doi: 10.1002/cbic.201800735. Epub 2019 Mar 26.
23 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
24 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
25 Mapping Protein Targets of Bioactive Small Molecules Using Lipid-Based Chemical Proteomics. ACS Chem Biol. 2017 Oct 20;12(10):2671-2681. doi: 10.1021/acschembio.7b00581. Epub 2017 Sep 20.
Mass spectrometry data entry: PXD007570