Details of the Target
General Information of Target
| Target ID | LDTP12982 | |||||
|---|---|---|---|---|---|---|
| Target Name | Mitochondrial import receptor subunit TOM7 homolog (TOMM7) | |||||
| Gene Name | TOMM7 | |||||
| Gene ID | 54543 | |||||
| Synonyms |
TOM7; TOMM07; Mitochondrial import receptor subunit TOM7 homolog; Translocase of outer membrane 7 kDa subunit homolog |
|||||
| 3D Structure | ||||||
| Sequence |
MKLLSLVAVVGCLLVPPAEANKSSEDIRCKCICPPYRNISGHIYNQNVSQKDCNCLHVVE
PMPVPGHDVEAYCLLCECRYEERSTTTIKVIIVIYLSVVGALLLYMAFLMLVDPLIRKPD AYTEQLHNEEENEDARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHK MLS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Tom7 family
|
|||||
| Subcellular location |
Mitochondrion outer membrane
|
|||||
| Function |
Required for assembly and stability of the TOM complex. Positive regulator of PRKN translocation to damaged mitochondria. Acts probably by stabilizing PINK1 on the outer membrane of depolarized mitochondria.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K17(1.19) | LDD0277 | [1] | |
|
NHS Probe Info |
![]() |
N.A. | LDD0010 | [2] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C055 Probe Info |
![]() |
13.09 | LDD1752 | [3] | |
|
C056 Probe Info |
![]() |
29.04 | LDD1753 | [3] | |
|
C094 Probe Info |
![]() |
23.10 | LDD1785 | [3] | |
|
C112 Probe Info |
![]() |
20.25 | LDD1799 | [3] | |
|
C134 Probe Info |
![]() |
25.81 | LDD1816 | [3] | |
|
C210 Probe Info |
![]() |
41.07 | LDD1884 | [3] | |
|
C218 Probe Info |
![]() |
19.43 | LDD1892 | [3] | |
|
C231 Probe Info |
![]() |
25.63 | LDD1904 | [3] | |
|
C232 Probe Info |
![]() |
53.82 | LDD1905 | [3] | |
|
C234 Probe Info |
![]() |
7.62 | LDD1907 | [3] | |
|
C235 Probe Info |
![]() |
69.55 | LDD1908 | [3] | |
|
C238 Probe Info |
![]() |
12.30 | LDD1911 | [3] | |
|
C243 Probe Info |
![]() |
16.45 | LDD1916 | [3] | |
|
C246 Probe Info |
![]() |
27.67 | LDD1919 | [3] | |
|
C249 Probe Info |
![]() |
12.73 | LDD1922 | [3] | |
|
C285 Probe Info |
![]() |
84.45 | LDD1955 | [3] | |
|
C287 Probe Info |
![]() |
20.53 | LDD1957 | [3] | |
|
C288 Probe Info |
![]() |
7.06 | LDD1958 | [3] | |
|
C289 Probe Info |
![]() |
99.73 | LDD1959 | [3] | |
|
C299 Probe Info |
![]() |
8.40 | LDD1968 | [3] | |
|
C355 Probe Info |
![]() |
23.26 | LDD2016 | [3] | |
The Interaction Atlas With This Target
References























