Details of the Target
General Information of Target
Target ID | LDTP12979 | |||||
---|---|---|---|---|---|---|
Target Name | Transmembrane protein 14C (TMEM14C) | |||||
Gene Name | TMEM14C | |||||
Gene ID | 51522 | |||||
Synonyms |
C6orf53; Transmembrane protein 14C |
|||||
3D Structure | ||||||
Sequence |
MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFFSVPVAWTLTNIIHNLGM
YVFLHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYD PTHFILNTASLLSVLIPKMPQLHGVRIFGINKY |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
TMEM14 family
|
|||||
Subcellular location |
Mitochondrion membrane
|
|||||
Function | Required for normal heme biosynthesis. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
TH211 Probe Info |
![]() |
Y81(20.00) | LDD0260 | [1] | |
Probe 1 Probe Info |
![]() |
Y81(15.88) | LDD3495 | [2] | |
HPAP Probe Info |
![]() |
3.77 | LDD0063 | [3] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [4] | |
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [4] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C040 Probe Info |
![]() |
10.93 | LDD1740 | [5] | |
C041 Probe Info |
![]() |
5.54 | LDD1741 | [5] | |
C056 Probe Info |
![]() |
20.82 | LDD1753 | [5] | |
C091 Probe Info |
![]() |
11.79 | LDD1782 | [5] | |
C092 Probe Info |
![]() |
22.16 | LDD1783 | [5] | |
C094 Probe Info |
![]() |
93.70 | LDD1785 | [5] | |
C112 Probe Info |
![]() |
19.16 | LDD1799 | [5] | |
C134 Probe Info |
![]() |
21.26 | LDD1816 | [5] | |
C201 Probe Info |
![]() |
28.44 | LDD1877 | [5] | |
C210 Probe Info |
![]() |
53.08 | LDD1884 | [5] | |
C225 Probe Info |
![]() |
4.92 | LDD1898 | [5] | |
C228 Probe Info |
![]() |
25.11 | LDD1901 | [5] | |
C235 Probe Info |
![]() |
19.16 | LDD1908 | [5] | |
C238 Probe Info |
![]() |
11.16 | LDD1911 | [5] | |
C278 Probe Info |
![]() |
49.87 | LDD1948 | [5] | |
C289 Probe Info |
![]() |
30.06 | LDD1959 | [5] | |
C362 Probe Info |
![]() |
49.18 | LDD2023 | [5] | |
C366 Probe Info |
![]() |
6.11 | LDD2027 | [5] | |
C388 Probe Info |
![]() |
55.33 | LDD2047 | [5] | |
FFF probe11 Probe Info |
![]() |
12.14 | LDD0471 | [6] | |
FFF probe14 Probe Info |
![]() |
20.00 | LDD0477 | [6] | |
OEA-DA Probe Info |
![]() |
3.38 | LDD0046 | [7] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) | BZIP family | Q96BA8 |
GPCR
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Probable G-protein coupled receptor 152 (GPR152) | G-protein coupled receptor 1 family | Q8TDT2 |
Immunoglobulin
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1) | . | Q68D85 | |||
V-type immunoglobulin domain-containing suppressor of T-cell activation (VSIR) | . | Q9H7M9 |
Other
References