Details of the Target
General Information of Target
| Target ID | LDTP09814 | |||||
|---|---|---|---|---|---|---|
| Target Name | Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 (LPGAT1) | |||||
| Gene Name | LPGAT1 | |||||
| Gene ID | 9926 | |||||
| Synonyms |
FAM34A; KIAA0205; Acyl-CoA:lysophosphatidylglycerol acyltransferase 1; 2-acylglycerophosphocholine O-acyltransferase; EC 2.3.1.62; Acyl-CoA:monoacylglycerol acyltransferase LPGAT1; EC 2.3.1.22; Lysophospholipid acyltransferase 7; LPLAT7; EC 2.3.1.-; Stearoyl-CoA:1-lyso-2-acyl-PE acyltransferase
|
|||||
| 3D Structure | ||||||
| Sequence |
MHSLATAAPVPTTLAQVDREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSF
GTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLY PFLHTVSKTRPFEYLRLTSLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKT VATFILQKILLDDTGLAYICQTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLS DNPRAREALRQCLPDQLKDTTFAQVLKDDTTTKRWLAQLVKNLQEGQVTDPRGIPLPPQ |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
1-acyl-sn-glycerol-3-phosphate acyltransferase family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Lysophospholipid acyltransferase involved in fatty acyl chain remodeling of glycerophospholipids in the endoplasmic reticulum membrane. Selectively catalyzes the transfer and esterification of saturated long-chain fatty acids from acyl-CoA to the sn-1 position of 1-lyso-2-acyl phosphatidylethanolamines (1-lyso-PE, LPE), with a preference for stearoyl CoA over palmitoyl CoA as acyl donor. Acts in concert with an unknown phospholipase A1 to convert palmitate phosphatidylethanolamine (PE) species into stearate ones. Provides substrates to the PE methylation pathway, controlling stearate/palmitate composition of PE and phosphatidylcholine (PC) species with an overall impact on de novo hepatic lipid synthesis, body fat content and life span. Can acylate lysophosphatidylglycerols (LPG) using various saturated fatty acyl-CoAs as acyl donors. Can also acylate monoacylglycerols with a preference for 2-monoacylglycerols over 1-monoacylglycerols. Has no activity toward lysophosphatidic acids (LPA).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K164(10.00); K165(8.33); K219(10.00) | LDD0277 | [1] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C022 Probe Info |
![]() |
7.57 | LDD1728 | [2] | |
|
C040 Probe Info |
![]() |
9.78 | LDD1740 | [2] | |
|
C056 Probe Info |
![]() |
18.13 | LDD1753 | [2] | |
|
C091 Probe Info |
![]() |
9.99 | LDD1782 | [2] | |
|
C092 Probe Info |
![]() |
17.88 | LDD1783 | [2] | |
|
C094 Probe Info |
![]() |
28.25 | LDD1785 | [2] | |
|
C112 Probe Info |
![]() |
20.11 | LDD1799 | [2] | |
|
C134 Probe Info |
![]() |
20.11 | LDD1816 | [2] | |
|
C201 Probe Info |
![]() |
23.92 | LDD1877 | [2] | |
|
C228 Probe Info |
![]() |
16.45 | LDD1901 | [2] | |
|
C231 Probe Info |
![]() |
19.29 | LDD1904 | [2] | |
|
C235 Probe Info |
![]() |
19.97 | LDD1908 | [2] | |
|
C289 Probe Info |
![]() |
36.25 | LDD1959 | [2] | |
|
C343 Probe Info |
![]() |
11.63 | LDD2005 | [2] | |
|
C349 Probe Info |
![]() |
14.42 | LDD2010 | [2] | |
|
C350 Probe Info |
![]() |
30.70 | LDD2011 | [2] | |
|
C362 Probe Info |
![]() |
29.04 | LDD2023 | [2] | |
|
C388 Probe Info |
![]() |
39.12 | LDD2047 | [2] | |
|
C407 Probe Info |
![]() |
10.85 | LDD2064 | [2] | |
|
FFF probe11 Probe Info |
![]() |
20.00 | LDD0471 | [3] | |
|
FFF probe14 Probe Info |
![]() |
20.00 | LDD0477 | [3] | |
|
OEA-DA Probe Info |
![]() |
8.45 | LDD0046 | [4] | |
References























