Details of the Target
General Information of Target
| Target ID | LDTP00573 | |||||
|---|---|---|---|---|---|---|
| Target Name | Prefoldin subunit 6 (PFDN6) | |||||
| Gene Name | PFDN6 | |||||
| Gene ID | 10471 | |||||
| Synonyms |
HKE2; PFD6; Prefoldin subunit 6; Protein Ke2 |
|||||
| 3D Structure | ||||||
| Sequence |
MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLL
GPVLVKQELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQA AKAGAPGKA |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Prefoldin subunit beta family
|
|||||
| Function |
Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TH211 Probe Info |
![]() |
Y16(5.39) | LDD0257 | [1] | |
|
ONAyne Probe Info |
![]() |
K122(6.78) | LDD0274 | [2] | |
|
AZ-9 Probe Info |
![]() |
E114(0.77) | LDD2208 | [3] | |
|
Probe 1 Probe Info |
![]() |
Y16(140.32); Y82(19.61); Y90(44.51) | LDD3495 | [4] | |
|
HHS-482 Probe Info |
![]() |
Y16(1.20) | LDD0287 | [5] | |
|
HHS-475 Probe Info |
![]() |
Y16(0.89); Y82(0.99) | LDD0264 | [6] | |
|
HHS-465 Probe Info |
![]() |
Y16(10.00); Y82(8.79) | LDD2237 | [7] | |
|
ATP probe Probe Info |
![]() |
K21(0.00); K25(0.00); K66(0.00); K8(0.00) | LDD0199 | [8] | |
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [9] | |
|
STPyne Probe Info |
![]() |
N.A. | LDD0009 | [10] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C003 Probe Info |
![]() |
18.25 | LDD1713 | [11] | |
|
C056 Probe Info |
![]() |
18.64 | LDD1753 | [11] | |
|
C158 Probe Info |
![]() |
9.99 | LDD1838 | [11] | |
|
C249 Probe Info |
![]() |
16.45 | LDD1922 | [11] | |
|
C284 Probe Info |
![]() |
21.71 | LDD1954 | [11] | |
|
C296 Probe Info |
![]() |
12.55 | LDD1966 | [11] | |
|
C305 Probe Info |
![]() |
10.06 | LDD1974 | [11] | |
|
C313 Probe Info |
![]() |
13.55 | LDD1980 | [11] | |
|
C314 Probe Info |
![]() |
14.83 | LDD1981 | [11] | |
|
C326 Probe Info |
![]() |
11.00 | LDD1990 | [11] | |
|
C349 Probe Info |
![]() |
10.34 | LDD2010 | [11] | |
|
C350 Probe Info |
![]() |
24.25 | LDD2011 | [11] | |
|
C354 Probe Info |
![]() |
9.06 | LDD2015 | [11] | |
|
C355 Probe Info |
![]() |
24.25 | LDD2016 | [11] | |
|
C361 Probe Info |
![]() |
18.51 | LDD2022 | [11] | |
|
C362 Probe Info |
![]() |
30.70 | LDD2023 | [11] | |
|
C364 Probe Info |
![]() |
17.75 | LDD2025 | [11] | |
|
C391 Probe Info |
![]() |
16.45 | LDD2050 | [11] | |
|
C397 Probe Info |
![]() |
10.48 | LDD2056 | [11] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0116 | HHS-0101 | DM93 | Y16(0.89); Y82(0.99) | LDD0264 | [6] |
| LDCM0117 | HHS-0201 | DM93 | Y16(0.78); Y82(0.86) | LDD0265 | [6] |
| LDCM0118 | HHS-0301 | DM93 | Y16(0.77); Y82(0.91) | LDD0266 | [6] |
| LDCM0119 | HHS-0401 | DM93 | Y16(0.80); Y82(0.87) | LDD0267 | [6] |
| LDCM0120 | HHS-0701 | DM93 | Y16(0.83); Y82(0.93) | LDD0268 | [6] |
| LDCM0125 | JWB146 | DM93 | Y16(1.20) | LDD0287 | [5] |
| LDCM0127 | JWB152 | DM93 | Y16(0.69) | LDD0289 | [5] |
| LDCM0129 | JWB202 | DM93 | Y16(0.37) | LDD0291 | [5] |
| LDCM0130 | JWB211 | DM93 | Y16(0.21) | LDD0292 | [5] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Fibroblast growth factor receptor 3 (FGFR3) | Tyr protein kinase family | P22607 | |||
| F-box only protein 2 (FBXO2) | . | Q9UK22 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| CCAAT/enhancer-binding protein gamma (CEBPG) | BZIP family | P53567 | |||
Other
References





























