Details of the Target
General Information of Target
Target ID | LDTP11733 | |||||
---|---|---|---|---|---|---|
Target Name | Ras-related protein Rab-1B (RAB1B) | |||||
Gene Name | RAB1B | |||||
Gene ID | 81876 | |||||
Synonyms |
Ras-related protein Rab-1B; EC 3.6.5.2 |
|||||
3D Structure | ||||||
Sequence |
MAARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRPVIRMNGDK
FRRLVKAPPRNYSVIVMFTALQLHRQCVVCKQADEEFQILANSWRYSSAFTNRIFFAMVD FDEGSDVFQMLNMNSAPTFINFPAKGKPKRGDTYELQVRGFSAEQIARWIADRTDVNIRV IRPPNYAGPLMLGLLLAVIGGLVYLRRSNMEFLFNKTGWAFAALCFVLAMTSGQMWNHIR GPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRK IMCVAGIGLVVLFFSWMLSIFRSKYHGYPYSFLMS |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Small GTPase superfamily, Rab family
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function |
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Regulates vesicular transport between the endoplasmic reticulum and successive Golgi compartments. Required to modulate the compacted morphology of the Golgi. Promotes the recruitment of lipid phosphatase MTMR6 to the endoplasmic reticulum-Golgi intermediate compartment.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
m-APA Probe Info |
![]() |
10.21 | LDD0402 | [1] | |
A-EBA Probe Info |
![]() |
5.91 | LDD0215 | [2] | |
C-Sul Probe Info |
![]() |
3.02 | LDD0066 | [3] | |
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [4] | |
ONAyne Probe Info |
![]() |
K128(10.00); K55(0.17) | LDD0274 | [5] | |
STPyne Probe Info |
![]() |
K122(8.12); K128(8.22); K129(7.33); K170(6.47) | LDD0277 | [5] | |
AZ-9 Probe Info |
![]() |
E51(1.09) | LDD2208 | [6] | |
AF-1 Probe Info |
![]() |
10.00 | LDD0421 | [7] | |
AF-2 Probe Info |
![]() |
10.00 | LDD0422 | [7] | |
HHS-475 Probe Info |
![]() |
Y109(1.03) | LDD0264 | [8] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0227 | [9] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0163 | [10] | |
TFBX Probe Info |
![]() |
N.A. | LDD0027 | [11] | |
SF Probe Info |
![]() |
Y78(0.00); Y109(0.00); Y77(0.00); Y7(0.00) | LDD0028 | [12] | |
1c-yne Probe Info |
![]() |
N.A. | LDD0228 | [13] | |
AOyne Probe Info |
![]() |
6.50 | LDD0443 | [14] | |
MPP-AC Probe Info |
![]() |
N.A. | LDD0428 | [15] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [16] | |
TER-AC Probe Info |
![]() |
N.A. | LDD0426 | [15] | |
HHS-465 Probe Info |
![]() |
N.A. | LDD2240 | [17] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C040 Probe Info |
![]() |
8.69 | LDD1740 | [18] | |
C094 Probe Info |
![]() |
23.59 | LDD1785 | [18] | |
C112 Probe Info |
![]() |
17.03 | LDD1799 | [18] | |
C169 Probe Info |
![]() |
19.84 | LDD1849 | [18] | |
C232 Probe Info |
![]() |
35.75 | LDD1905 | [18] | |
C235 Probe Info |
![]() |
24.93 | LDD1908 | [18] | |
C264 Probe Info |
![]() |
17.27 | LDD1935 | [18] | |
C265 Probe Info |
![]() |
13.36 | LDD1936 | [18] | |
C299 Probe Info |
![]() |
5.98 | LDD1968 | [18] | |
C362 Probe Info |
![]() |
61.82 | LDD2023 | [18] | |
C364 Probe Info |
![]() |
16.68 | LDD2025 | [18] | |
C366 Probe Info |
![]() |
6.23 | LDD2027 | [18] | |
C390 Probe Info |
![]() |
23.75 | LDD2049 | [18] | |
FFF probe11 Probe Info |
![]() |
8.13 | LDD0471 | [19] | |
FFF probe13 Probe Info |
![]() |
15.95 | LDD0475 | [19] | |
FFF probe14 Probe Info |
![]() |
12.10 | LDD0477 | [19] | |
FFF probe2 Probe Info |
![]() |
6.75 | LDD0463 | [19] | |
FFF probe3 Probe Info |
![]() |
20.00 | LDD0464 | [19] | |
JN0003 Probe Info |
![]() |
9.65 | LDD0469 | [19] | |
DFG-out-4 Probe Info |
![]() |
4.30 | LDD0075 | [20] | |
OEA-DA Probe Info |
![]() |
4.42 | LDD0046 | [21] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0166 | Afatinib | A431 | 10.00 | LDD0421 | [7] |
LDCM0156 | Aniline | NCI-H1299 | 11.42 | LDD0403 | [1] |
LDCM0017 | DFG-out-2 | A431 | 4.30 | LDD0075 | [20] |
LDCM0116 | HHS-0101 | DM93 | Y109(1.03) | LDD0264 | [8] |
LDCM0117 | HHS-0201 | DM93 | Y109(1.06) | LDD0265 | [8] |
LDCM0118 | HHS-0301 | DM93 | Y109(0.98) | LDD0266 | [8] |
LDCM0119 | HHS-0401 | DM93 | Y109(1.25) | LDD0267 | [8] |
LDCM0120 | HHS-0701 | DM93 | Y109(0.82) | LDD0268 | [8] |
LDCM0109 | NEM | HeLa | N.A. | LDD0227 | [9] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Guanine nucleotide exchange factor MSS4 (RABIF) | DSS4/MSS4 family | P47224 |
References