Details of the Target
General Information of Target
| Target ID | LDTP10966 | |||||
|---|---|---|---|---|---|---|
| Target Name | Microsomal glutathione S-transferase 2 (MGST2) | |||||
| Gene Name | MGST2 | |||||
| Gene ID | 4258 | |||||
| Synonyms |
GST2; Microsomal glutathione S-transferase 2; Microsomal GST-2; EC 2.5.1.18; Glutathione peroxidase MGST2; EC 1.11.1.-; Leukotriene C4 synthase MGST2; EC 4.4.1.20; Microsomal glutathione S-transferase II; Microsomal GST-II
|
|||||
| 3D Structure | ||||||
| Sequence |
MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLP
KAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAE SEWHSENEEEEKLAGDMKSKVVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEY DEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFTNSVLTKTYKMKSEPDKADPFSFE GPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASG DGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGD EEGEDEDDAEINPKV |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
MAPEG family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Catalyzes several different glutathione-dependent reactions. Catalyzes the glutathione-dependent reduction of lipid hydroperoxides, such as 5-HPETE. Has glutathione transferase activity, toward xenobiotic electrophiles, such as 1-chloro-2, 4-dinitrobenzene (CDNB). Catalyzes also the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4 (LTC4). Involved in oxidative DNA damage induced by ER stress and anticancer agents by activating LTC4 biosynthetic machinery in nonimmune cells.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
HDSF-alk Probe Info |
![]() |
1.74 | LDD0197 | [1] | |
|
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [2] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [3] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C011 Probe Info |
![]() |
6.28 | LDD1720 | [4] | |
|
C056 Probe Info |
![]() |
17.75 | LDD1753 | [4] | |
|
C091 Probe Info |
![]() |
14.93 | LDD1782 | [4] | |
|
C092 Probe Info |
![]() |
23.75 | LDD1783 | [4] | |
|
C094 Probe Info |
![]() |
43.11 | LDD1785 | [4] | |
|
C134 Probe Info |
![]() |
20.82 | LDD1816 | [4] | |
|
C143 Probe Info |
![]() |
12.73 | LDD1825 | [4] | |
|
C201 Probe Info |
![]() |
26.17 | LDD1877 | [4] | |
|
C218 Probe Info |
![]() |
12.55 | LDD1892 | [4] | |
|
C220 Probe Info |
![]() |
15.67 | LDD1894 | [4] | |
|
C264 Probe Info |
![]() |
18.77 | LDD1935 | [4] | |
|
C349 Probe Info |
![]() |
10.63 | LDD2010 | [4] | |
|
C350 Probe Info |
![]() |
28.64 | LDD2011 | [4] | |
|
C362 Probe Info |
![]() |
26.35 | LDD2023 | [4] | |
|
C388 Probe Info |
![]() |
39.12 | LDD2047 | [4] | |
|
C407 Probe Info |
![]() |
12.13 | LDD2064 | [4] | |
|
STS-2 Probe Info |
![]() |
N.A. | LDD0138 | [5] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) | BZIP family | Q96BA8 | |||
Cytokine and receptor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| C-C motif chemokine 3-like 1 (CCL3L1; CCL3L3) | Intercrine beta (chemokine CC) family | P16619 | |||
Other
References




















