Details of the Target

General Information of Target

Target ID LDTP02053
Target Name Heat shock protein beta-1 (HSPB1)
Gene Name HSPB1
Gene ID 3315
Synonyms
HSP27; HSP28; Heat shock protein beta-1; HspB1; 28 kDa heat shock protein; Estrogen-regulated 24 kDa protein; Heat shock 27 kDa protein; HSP 27; Stress-responsive protein 27; SRP27
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP
AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI
TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT
IPVTFESRAQLGGPEAAKSDETAAK
Target Type
Clinical trial
Target Bioclass
Other
Family
Small heat shock protein (HSP20) family
Subcellular location
Cytoplasm
Function
Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Plays a role in stress resistance and actin organization. Through its molecular chaperone activity may regulate numerous biological processes including the phosphorylation and the axonal transport of neurofilament proteins.
TTD ID
T39921
Uniprot ID
P04792
DrugMap ID
TT5IP87
Ensemble ID
ENST00000248553.7
HGNC ID
HGNC:5246
ChEMBL ID
CHEMBL5976

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 29 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
P8
 Probe Info  		3.81  LDD0451  [2]
A-EBA
 Probe Info  		3.27  LDD0215  [3]
CY-1
 Probe Info  		100.00  LDD0243  [4]
CY4
 Probe Info  		100.00  LDD0244  [4]
N1
 Probe Info  		100.00  LDD0242  [4]
TH211
 Probe Info  		Y54(7.77); Y73(7.43); Y23(6.32)  LDD0257  [5]
TH214
 Probe Info  		Y23(11.30)  LDD0258  [5]
TH216
 Probe Info  		Y23(20.00); Y54(8.53)  LDD0259  [5]
YN-1
 Probe Info  		100.00  LDD0444  [6]
ONAyne
 Probe Info  		K112(0.84); K123(0.22); K198(6.44)  LDD0274  [7]
STPyne
 Probe Info  		K112(8.86); K123(7.05); K198(0.93)  LDD0277  [7]
AZ-9
 Probe Info  		E178(0.74); E195(0.98); E186(0.81); D30(10.00)  LDD2208  [8]
OPA-S-S-alkyne
 Probe Info  		K123(2.35)  LDD3494  [9]
Probe 1
 Probe Info  		Y23(19.05); Y133(41.53)  LDD3495  [10]
HPAP
 Probe Info  		4.61  LDD0063  [11]
EA-probe
 Probe Info  		N.A.  LDD0440  [12]
HHS-482
 Probe Info  		Y133(0.98); Y23(0.79); Y54(0.88); Y73(1.20)  LDD0285  [13]
HHS-475
 Probe Info  		Y73(0.86); Y54(0.89); Y23(0.94); Y133(0.96)  LDD0264  [14]
HHS-465
 Probe Info  		Y23(10.00)  LDD2237  [15]
5E-2FA
 Probe Info  		H124(0.00); H25(0.00); H131(0.00); H103(0.00)  LDD2235  [16]
ATP probe
 Probe Info  		N.A.  LDD0199  [17]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [18]
Ox-W18
 Probe Info  		N.A.  LDD2175  [19]
1d-yne
 Probe Info  		N.A.  LDD0357  [20]
Acrolein
 Probe Info  		H103(0.00); H131(0.00)  LDD0217  [21]
Crotonaldehyde
 Probe Info  		H103(0.00); H25(0.00); H131(0.00)  LDD0219  [21]
Methacrolein
 Probe Info  		H103(0.00); H131(0.00)  LDD0218  [21]
AOyne
 Probe Info  		15.00  LDD0443  [22]
PAL-AfBPP Probe
Click To Hide/Show 14 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IMP2070
 Probe Info  		1.88  LDD0367  [23]
C392
 Probe Info  		9.13  LDD2051  [24]
FFF probe11
 Probe Info  		20.00  LDD0471  [25]
FFF probe12
 Probe Info  		20.00  LDD0473  [25]
FFF probe13
 Probe Info  		20.00  LDD0475  [25]
FFF probe14
 Probe Info  		20.00  LDD0477  [25]
FFF probe2
 Probe Info  		20.00  LDD0463  [25]
FFF probe3
 Probe Info  		20.00  LDD0464  [25]
FFF probe6
 Probe Info  		5.17  LDD0468  [25]
JN0003
 Probe Info  		20.00  LDD0469  [25]
STS-2
 Probe Info  		N.A.  LDD0138  [26]
Photonaproxen
 Probe Info  		N.A.  LDD0156  [27]
OEA-DA
 Probe Info  		14.22  LDD0046  [28]
STS-1
 Probe Info  		N.A.  LDD0068  [29]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 13.36  LDD0403  [1]
 LDCM0108  Chloroacetamide HeLa H103(0.00); H25(0.00); H131(0.00)  LDD0222  [21]
 LDCM0193  Compound 36 HEK-293T 5.42  LDD0511  [25]
 LDCM0175  Ethacrynic acid HeLa N.A.  LDD0440  [12]
 LDCM0116  HHS-0101 DM93 Y73(0.86); Y54(0.89); Y23(0.94); Y133(0.96)  LDD0264  [14]
 LDCM0117  HHS-0201 DM93 Y73(0.76); Y54(0.78); Y133(0.84); Y23(0.85)  LDD0265  [14]
 LDCM0118  HHS-0301 DM93 Y23(0.79); Y133(0.80); Y73(0.80); Y54(0.83)  LDD0266  [14]
 LDCM0119  HHS-0401 DM93 Y133(0.91); Y54(0.92); Y73(0.93); Y23(0.93)  LDD0267  [14]
 LDCM0120  HHS-0701 DM93 Y73(1.47); Y54(1.49); Y133(1.62); Y23(1.68)  LDD0268  [14]
 LDCM0107  IAA HeLa H103(0.00); H131(0.00); H25(0.00)  LDD0221  [21]
 LDCM0123  JWB131 DM93 Y133(0.98); Y23(0.79); Y54(0.88); Y73(1.20)  LDD0285  [13]
 LDCM0124  JWB142 DM93 Y133(0.87); Y23(0.52); Y54(0.55); Y73(0.79)  LDD0286  [13]
 LDCM0125  JWB146 DM93 Y133(1.08); Y23(1.06); Y54(0.87); Y73(1.64)  LDD0287  [13]
 LDCM0126  JWB150 DM93 Y133(2.48); Y23(1.87); Y54(1.64); Y73(2.20)  LDD0288  [13]
 LDCM0127  JWB152 DM93 Y133(1.73); Y23(1.45); Y54(1.44); Y73(1.84)  LDD0289  [13]
 LDCM0128  JWB198 DM93 Y133(0.91); Y23(0.89); Y54(0.90); Y73(1.32)  LDD0290  [13]
 LDCM0129  JWB202 DM93 Y133(0.63); Y23(0.55); Y54(0.45); Y73(0.53)  LDD0291  [13]
 LDCM0130  JWB211 DM93 Y133(0.96); Y23(0.83); Y54(0.73); Y73(1.47)  LDD0292  [13]
 LDCM0109  NEM HeLa H103(0.00); H131(0.00); H25(0.00)  LDD0223  [21]
 LDCM0014  Panhematin K562 4.61  LDD0063  [11]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 48 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 5'-AMP-activated protein kinase beta subunit family O43741
26S proteasome regulatory subunit 10B (PSMC6) AAA ATPase family P62333
Glutamine--tRNA ligase (QARS1) Class-I aminoacyl-tRNA synthetase family P47897
COP9 signalosome complex subunit 3 (COPS3) CSN3 family Q9UNS2
ATP-dependent RNA helicase DDX39A (DDX39A) DEAD box helicase family O00148
Eukaryotic initiation factor 4A-II (EIF4A2) DEAD box helicase family Q14240
Eukaryotic translation initiation factor 3 subunit F (EIF3F) EIF-3 subunit F family O00303
DNA-directed RNA polymerase III subunit RPC6 (POLR3F) Eukaryotic RPC34/RPC39 RNA polymerase subunit family Q9H1D9
Fructose-1,6-bisphosphatase isozyme 2 (FBP2) FBPase class 1 family O00757
Ferritin heavy chain (FTH1) Ferritin family P02794
Glucose-fructose oxidoreductase domain-containing protein 1 (GFOD1) Gfo/Idh/MocA family Q9NXC2
Glucose-6-phosphate 1-dehydrogenase (G6PD) Glucose-6-phosphate dehydrogenase family P11413
Glutathione S-transferase omega-1 (GSTO1) Omega family P78417
X-ray repair cross-complementing protein 5 (XRCC5) Ku80 family P13010
Phosphatidate phosphatase LPIN1 (LPIN1) Lipin family Q14693
Lysyl oxidase homolog 4 (LOXL4) Lysyl oxidase family Q96JB6
Dihydropyrimidinase-related protein 5 (DPYSL5) Hydantoinase/dihydropyrimidinase family Q9BPU6
Peptidoglycan recognition protein 3 (PGLYRP3) N-acetylmuramoyl-L-alanine amidase 2 family Q96LB9
Diphosphoinositol polyphosphate phosphohydrolase 2 (NUDT4) Nudix hydrolase family Q9NZJ9
Calpain-10 (CAPN10) Peptidase C2 family Q9HC96
Ubiquitin thioesterase OTUB1 (OTUB1) Peptidase C65 family Q96FW1
Neprilysin (MME) Peptidase M13 family P08473
MPN domain-containing protein (MPND) Peptidase M67 family Q8N594
Phosphopentomutase (PGM2) Phosphohexose mutase family Q96G03
E3 SUMO-protein ligase PIAS1 (PIAS1) PIAS family O75925
Protein prune homolog 2 (PRUNE2) PPase class C family Q8WUY3
MAP kinase-activated protein kinase 2 (MAPKAPK2) CAMK Ser/Thr protein kinase family P49137
MAP kinase-activated protein kinase 3 (MAPKAPK3) CAMK Ser/Thr protein kinase family Q16644
MAP kinase-activated protein kinase 5 (MAPKAPK5) CAMK Ser/Thr protein kinase family Q8IW41
Mitogen-activated protein kinase kinase kinase 5 (MAP3K5) STE Ser/Thr protein kinase family Q99683
Ribose-phosphate pyrophosphokinase 2 (PRPS2) Ribose-phosphate pyrophosphokinase family P11908
Ribonuclease H2 subunit C (RNASEH2C) RNase H2 subunit C family Q8TDP1
E3 ubiquitin-protein ligase RNF10 (RNF10) RNF10 family Q8N5U6
3-ketodihydrosphingosine reductase (KDSR) Short-chain dehydrogenases/reductases (SDR) family Q06136
E3 ubiquitin-protein ligase TRIM23 (TRIM23) Arf family P36406
Ras-related protein Rab-43 (RAB43) Rab family Q86YS6
Inactive C-alpha-formylglycine-generating enzyme 2 (SUMF2) Sulfatase-modifying factor family Q8NBJ7
Terminal nucleotidyltransferase 5B (TENT5B) TENT family Q96A09
116 kDa U5 small nuclear ribonucleoprotein component (EFTUD2) Classic translation factor GTPase family Q15029
Ubiquitin-conjugating enzyme E2 E3 (UBE2E3) Ubiquitin-conjugating enzyme family Q969T4
Ubiquitin-conjugating enzyme E2 Q2 (UBE2Q2) Ubiquitin-conjugating enzyme family Q8WVN8
E3 ubiquitin-protein ligase HUWE1 (HUWE1) UPL family Q7Z6Z7
G/T mismatch-specific thymine DNA glycosylase (TDG) TDG/mug family Q13569
Bifunctional peptidase and (3S)-lysyl hydroxylase JMJD7 (JMJD7) . P0C870
E3 ubiquitin-protein ligase CHIP (STUB1) . Q9UNE7
E3 ubiquitin-protein ligase RNF183 (RNF183) . Q96D59
Methyltransferase-like protein 27 (METTL27) . Q8N6F8
Peptidyl-prolyl cis-trans isomerase FKBP4 (FKBP4) . Q02790
Transporter and channel
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
14-3-3 protein zeta/delta (YWHAZ) 14-3-3 family P63104
Annexin A5 (ANXA5) Annexin family P08758
Amyloid-beta precursor protein (APP) APP family P05067
V-type proton ATPase subunit B, kidney isoform (ATP6V1B1) ATPase alpha/beta chains family P15313
Bcl-2 homologous antagonist/killer (BAK1) Bcl-2 family Q16611
Beclin-1 (BECN1) Beclin family Q14457
Calreticulin (CALR) Calreticulin family P27797
Voltage-dependent anion-selective channel protein 2 (VDAC2) Eukaryotic mitochondrial porin family P45880
Aquaporin-8 (AQP8) MIP/aquaporin (TC 1.A.8) family O94778
Cellular tumor antigen p53 (TP53) P53 family P04637
Alpha-crystallin A chain (CRYAA) Small heat shock protein (HSP20) family P02489
Alpha-crystallin B chain (CRYAB) Small heat shock protein (HSP20) family P02511
Mitochondrial import inner membrane translocase subunit Tim17-B (TIMM17B) Tim17/Tim22/Tim23 family O60830
p53 apoptosis effector related to PMP-22 (PERP) TMEM47 family Q96FX8
Membrane protein MLC1 (MLC1) . Q15049
Transcription factor
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Krueppel-like factor 3 (KLF3) Krueppel C2H2-type zinc-finger protein family P57682
Zinc finger protein 670 (ZNF670) Krueppel C2H2-type zinc-finger protein family Q9BS34
Nuclear receptor subfamily 1 group D member 2 (NR1D2) Nuclear hormone receptor family Q14995
Visual system homeobox 2 (VSX2) Paired homeobox family P58304
Krueppel-like factor 15 (KLF15) Sp1 C2H2-type zinc-finger protein family Q9UIH9
TSC22 domain family protein 4 (TSC22D4) TSC-22/Dip/Bun family Q9Y3Q8
Zinc finger protein ZXDC (ZXDC) ZXD family Q2QGD7
Achaete-scute homolog 4 (ASCL4) . Q6XD76
LIM/homeobox protein Lhx6 (LHX6) . Q9UPM6
Zinc finger and SCAN domain-containing protein 26 (ZSCAN26) . Q16670
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable G-protein coupled receptor 141 (GPR141) G-protein coupled receptor 1 family Q7Z602
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cytokine receptor-like factor 3 (CRLF3) Cytokine receptor-like factor 3 family Q8IUI8
Other
Click To Hide/Show 65 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Annexin A8 (ANXA8) Annexin family P13928
Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B) ANP32 family Q92688
BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1 (KCTD13) BACURD family Q8WZ19
Bcl-2-modifying factor (BMF) Bcl-2 family Q96LC9
COP9 signalosome complex subunit 7b (COPS7B) CSN7/EIF3M family Q9H9Q2
Cystatin-A (CSTA) Cystatin family P01040
Death domain-associated protein 6 (DAXX) DAXX family Q9UER7
Epithelial splicing regulatory protein 1 (ESRP1) ESRP family Q6NXG1
Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2) Eukaryotic initiation factor 4G family P78344
Protein pelota homolog (PELO) Eukaryotic release factor 1 family Q9BRX2
Protein FAM163A (FAM163A) FAM163 family Q96GL9
Protein FAM9A (FAM9A) FAM9 family Q8IZU1
Protein FAM98C (FAM98C) FAM98 family Q17RN3
Putative golgin subfamily A member 2B (GOLGA2P5) GOLGA2 family Q9HBQ8
Immunoglobulin-binding protein 1 (IGBP1) IGBP1/TAP42 family P78318
Keratin-like protein KRT222 (KRT222) Intermediate filament family Q8N1A0
Keratin-associated protein 19-7 (KRTAP19-7) KRTAP type 19 family Q3SYF9
Keratin-associated protein 8-1 (KRTAP8-1) KRTAP type 8 family Q8IUC2
Cytosolic iron-sulfur assembly component 2B (CIAO2B) MIP18 family Q9Y3D0
RNA polymerase II-associated factor 1 homolog (PAF1) PAF1 family Q8N7H5
Keratin-associated protein 13-3 (KRTAP13-3) PMG family Q3SY46
Splicing factor 3A subunit 3 (SF3A3) SF3A3 family Q12874
Heat shock protein beta-1 (HSPB1) Small heat shock protein (HSP20) family P04792
Heat shock protein beta-8 (HSPB8) Small heat shock protein (HSP20) family Q9UJY1
snRNA-activating protein complex subunit 3 (SNAPC3) SNAPC3/SRD2 family Q92966
SNW domain-containing protein 1 (SNW1) SNW family Q13573
Spindlin-1 (SPIN1) SPIN/STSY family Q9Y657
Protein sprouty homolog 4 (SPRY4) Sprouty family Q9C004
Protein TASOR 2 (TASOR2) TASOR family Q5VWN6
Translationally-controlled tumor protein (TPT1) TCTP family P13693
CST complex subunit TEN1 (TEN1) TEN1 family Q86WV5
Transcription elongation factor A protein-like 8 (TCEAL8) TFS-II family Q8IYN2
Tubulin beta-6 chain (TUBB6) Tubulin family Q9BUF5
Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A) Ubiquitin family; Eukaryotic ribosomal protein eS31 family P62979
Small ribosomal subunit protein uS2 (RPSA) Universal ribosomal protein uS2 family P08865
Small ribosomal subunit protein uS8 (RPS15A) Universal ribosomal protein uS8 family P62244
WD repeat domain-containing protein 83 (WDR83) WD repeat MORG1 family Q9BRX9
Abscission/NoCut checkpoint regulator (ZFYVE19) . Q96K21
ADP-ribosylation factor GTPase-activating protein 3 (ARFGAP3) . Q9NP61
BAG family molecular chaperone regulator 3 (BAG3) . O95817
CAP-Gly domain-containing linker protein 3 (CLIP3) . Q96DZ5
DNA fragmentation factor subunit alpha (DFFA) . O00273
Ephexin-1 (NGEF) . Q8N5V2
Fanconi anemia group G protein (FANCG) . O15287
Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1) . Q8TC84
G patch domain and ankyrin repeat-containing protein 1 (GPANK1) . O95872
G-protein-signaling modulator 3 (GPSM3) . Q9Y4H4
IQ motif and ubiquitin-like domain-containing protein (IQUB) . Q8NA54
Kelch-like protein 20 (KLHL20) . Q9Y2M5
Leukocyte receptor cluster member 8 (LENG8) . Q96PV6
Ligand of Numb protein X 2 (LNX2) . Q8N448
Methyl-CpG-binding protein 2 (MECP2) . P51608
Methylosome protein WDR77 (WDR77) . Q9BQA1
Necdin (NDN) . Q99608
Period circadian protein homolog 1 (PER1) . O15534
Pleckstrin homology domain-containing family G member 7 (PLEKHG7) . Q6ZR37
Protein FAM117B (FAM117B) . Q6P1L5
Putative uncharacterized protein RUSC1-AS1 (RUSC1-AS1) . Q66K80
Retinoic acid-induced protein 2 (RAI2) . Q9Y5P3
Shieldin complex subunit 1 (SHLD1) . Q8IYI0
Spermatogenesis-associated protein 8 (SPATA8) . Q6RVD6
Tetratricopeptide repeat protein 1 (TTC1) . Q99614
Uncharacterized protein C8orf48 (C8orf48) . Q96LL4
Uncharacterized protein KIAA0408 (KIAA0408) . Q6ZU52
Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) . Q8TBF4

The Drug(s) Related To This Target

Approved
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Artenimol . DB11638
Phase 2
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Azx-100 . D09IGR
Investigative
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Phenethyl Isothiocyanate Small molecular drug DB12695
Apatorsen . DB06094

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Comparison of Different Competitive Proteome Profiling Approaches in Target Identification of Covalent Inhibitors. Chembiochem. 2022 Dec 16;23(24):e202200389. doi: 10.1002/cbic.202200389. Epub 2022 Nov 22.
3 2-Ethynylbenzaldehyde-Based, Lysine-Targeting Irreversible Covalent Inhibitors for Protein Kinases and Nonkinases. J Am Chem Soc. 2023 Feb 12. doi: 10.1021/jacs.2c11595. Online ahead of print.
Mass spectrometry data entry: PXD037665
4 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.
5 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
6 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
7 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
8 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
9 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
10 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
11 A Chemical Proteomic Map of Heme-Protein Interactions. J Am Chem Soc. 2022 Aug 24;144(33):15013-15019. doi: 10.1021/jacs.2c06104. Epub 2022 Aug 12.
Mass spectrometry data entry: PXD034651
12 Chemoproteomic Profiling Reveals Ethacrynic Acid Targets Adenine Nucleotide Translocases to Impair Mitochondrial Function. Mol Pharm. 2018 Jun 4;15(6):2413-2422. doi: 10.1021/acs.molpharmaceut.8b00250. Epub 2018 May 15.
13 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
14 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
15 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
16 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
17 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
18 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
19 Oxidative cyclization reagents reveal tryptophan cation- interactions. Nature. 2024 Mar;627(8004):680-687. doi: 10.1038/s41586-024-07140-6. Epub 2024 Mar 6.
Mass spectrometry data entry: PXD001377 , PXD005252
20 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
21 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
22 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
23 A Probe for NLRP3 Inflammasome Inhibitor MCC950 Identifies Carbonic Anhydrase 2 as a Novel Target. ACS Chem Biol. 2021 Jun 18;16(6):982-990. doi: 10.1021/acschembio.1c00218. Epub 2021 May 18.
Mass spectrometry data entry: PXD024915 , PXD024913
24 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
25 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
26 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.
27 Small Molecule Interactome Mapping by Photoaffinity Labeling Reveals Binding Site Hotspots for the NSAIDs. J Am Chem Soc. 2018 Mar 28;140(12):4259-4268. doi: 10.1021/jacs.7b11639. Epub 2018 Mar 15.
Mass spectrometry data entry: PXD007094
28 Mapping Protein Targets of Bioactive Small Molecules Using Lipid-Based Chemical Proteomics. ACS Chem Biol. 2017 Oct 20;12(10):2671-2681. doi: 10.1021/acschembio.7b00581. Epub 2017 Sep 20.
Mass spectrometry data entry: PXD007570
29 Proteome profiling reveals potential cellular targets of staurosporine using a clickable cell-permeable probe. Chem Commun (Camb). 2011 Oct 28;47(40):11306-8. doi: 10.1039/c1cc14824a. Epub 2011 Sep 16.