Details of the Target

General Information of Target

Target ID LDTP02009
Target Name Cystatin-B (CSTB)
Gene Name CSTB
Gene ID 1476
Synonyms
CST6; STFB; Cystatin-B; CPI-B; Liver thiol proteinase inhibitor; Stefin-B
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVG
DEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
Target Bioclass
Transporter and channel
Family
Cystatin family
Subcellular location
Cytoplasm
Function This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.
Uniprot ID
P04080
Ensemble ID
ENST00000291568.7
HGNC ID
HGNC:2482

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 38 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
P3
 Probe Info  		10.00  LDD0450  [2]
CY4
 Probe Info  		100.00  LDD0244  [3]
TH211
 Probe Info  		Y97(20.00)  LDD0257  [4]
TH214
 Probe Info  		Y97(18.78)  LDD0258  [4]
TH216
 Probe Info  		Y97(20.00)  LDD0259  [4]
YN-1
 Probe Info  		100.00  LDD0444  [5]
ONAyne
 Probe Info  		N.A.  LDD0273  [6]
OPA-S-S-alkyne
 Probe Info  		K91(4.21)  LDD3494  [7]
Probe 1
 Probe Info  		Y53(42.28)  LDD3495  [8]
DA-P3
 Probe Info  		4.46  LDD0179  [9]
HHS-482
 Probe Info  		Y53(1.22); Y85(1.63); Y97(0.92)  LDD0285  [10]
HHS-475
 Probe Info  		Y85(0.79); Y53(0.80); Y97(0.96)  LDD0264  [11]
HHS-465
 Probe Info  		Y53(0.63); Y85(10.00); Y97(9.45)  LDD2237  [12]
Acrolein
 Probe Info  		H58(0.00); H92(0.00)  LDD0221  [13]
5E-2FA
 Probe Info  		H18(0.00); H75(0.00); H58(0.00)  LDD2235  [14]
ATP probe
 Probe Info  		K78(0.00); K39(0.00)  LDD0199  [15]
IA-alkyne
 Probe Info  		N.A.  LDD0162  [16]
ATP probe
 Probe Info  		K44(0.00); K30(0.00); K78(0.00)  LDD0035  [17]
BTD
 Probe Info  		N.A.  LDD0004  [18]
Dyn-2
 Probe Info  		N.A.  LDD0013  [18]
JW-RF-010
 Probe Info  		N.A.  LDD0026  [19]
NAIA_4
 Probe Info  		N.A.  LDD2226  [20]
TFBX
 Probe Info  		N.A.  LDD0027  [19]
WYneO
 Probe Info  		N.A.  LDD0022  [18]
aHNE
 Probe Info  		N.A.  LDD0001  [18]
DBIA
 Probe Info  		C3(12.13)  LDD2236  [21]
IPM
 Probe Info  		N.A.  LDD0005  [18]
NHS
 Probe Info  		K78(0.00); K39(0.00)  LDD0010  [18]
PF-06672131
 Probe Info  		N.A.  LDD0017  [22]
PPMS
 Probe Info  		N.A.  LDD0008  [18]
SF
 Probe Info  		Y97(0.00); K39(0.00)  LDD0028  [23]
STPyne
 Probe Info  		K39(0.00); K78(0.00)  LDD0009  [18]
VSF
 Probe Info  		N.A.  LDD0007  [18]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [24]
1c-yne
 Probe Info  		N.A.  LDD0228  [25]
AOyne
 Probe Info  		15.00  LDD0443  [26]
NAIA_5
 Probe Info  		N.A.  LDD2223  [20]
PAL-AfBPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C232
 Probe Info  		37.27  LDD1905  [27]
FFF probe4
 Probe Info  		6.63  LDD0466  [28]
Diazir
 Probe Info  		N.A.  LDD0011  [18]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 13.06  LDD0403  [1]
 LDCM0108  Chloroacetamide HeLa H58(0.00); H92(0.00)  LDD0222  [13]
 LDCM0632  CL-Sc Hep-G2 C3(1.08); C3(0.80)  LDD2227  [20]
 LDCM0634  CY-0357 Hep-G2 C3(0.67)  LDD2228  [20]
 LDCM0027  Dopamine HEK-293T 4.46  LDD0179  [9]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C3(1.81)  LDD1702  [29]
 LDCM0031  Epigallocatechin gallate HEK-293T 14.03  LDD0183  [9]
 LDCM0625  F8 Ramos C3(0.83)  LDD2187  [30]
 LDCM0572  Fragment10 Ramos C3(0.89)  LDD2189  [30]
 LDCM0574  Fragment12 Ramos C3(0.66)  LDD2191  [30]
 LDCM0575  Fragment13 Ramos C3(1.00)  LDD2192  [30]
 LDCM0576  Fragment14 Ramos C3(0.58)  LDD2193  [30]
 LDCM0579  Fragment20 Ramos C3(0.43)  LDD2194  [30]
 LDCM0580  Fragment21 Ramos C3(0.60)  LDD2195  [30]
 LDCM0582  Fragment23 Ramos C3(0.79)  LDD2196  [30]
 LDCM0578  Fragment27 Ramos C3(0.98)  LDD2197  [30]
 LDCM0588  Fragment30 Ramos C3(0.55)  LDD2199  [30]
 LDCM0589  Fragment31 Ramos C3(0.83)  LDD2200  [30]
 LDCM0590  Fragment32 Ramos C3(0.92)  LDD2201  [30]
 LDCM0596  Fragment38 Ramos C3(0.99)  LDD2203  [30]
 LDCM0566  Fragment4 Ramos C3(0.66)  LDD2184  [30]
 LDCM0614  Fragment56 Ramos C3(0.79)  LDD2205  [30]
 LDCM0569  Fragment7 Ramos C3(0.82)  LDD2186  [30]
 LDCM0571  Fragment9 Ramos C3(0.57)  LDD2188  [30]
 LDCM0116  HHS-0101 DM93 Y85(0.79); Y53(0.80); Y97(0.96)  LDD0264  [11]
 LDCM0117  HHS-0201 DM93 Y53(0.74); Y85(0.77); Y97(0.91)  LDD0265  [11]
 LDCM0118  HHS-0301 DM93 Y53(0.86); Y97(0.91); Y85(1.07)  LDD0266  [11]
 LDCM0119  HHS-0401 DM93 Y53(0.83); Y97(0.97); Y85(1.59)  LDD0267  [11]
 LDCM0120  HHS-0701 DM93 Y53(0.90); Y97(0.91); Y85(1.27)  LDD0268  [11]
 LDCM0107  IAA HeLa H58(0.00); H92(0.00)  LDD0221  [13]
 LDCM0123  JWB131 DM93 Y53(1.22); Y85(1.63); Y97(0.92)  LDD0285  [10]
 LDCM0124  JWB142 DM93 Y53(0.79); Y85(0.42); Y97(0.85)  LDD0286  [10]
 LDCM0125  JWB146 DM93 Y53(1.06); Y85(1.24); Y97(1.04)  LDD0287  [10]
 LDCM0126  JWB150 DM93 Y53(3.92); Y85(2.54); Y97(2.73)  LDD0288  [10]
 LDCM0127  JWB152 DM93 Y53(2.34); Y85(3.04); Y97(1.81)  LDD0289  [10]
 LDCM0128  JWB198 DM93 Y53(1.18); Y85(1.18); Y97(1.31)  LDD0290  [10]
 LDCM0129  JWB202 DM93 Y53(0.67); Y85(0.54); Y97(0.65)  LDD0291  [10]
 LDCM0130  JWB211 DM93 Y53(0.89); Y85(0.81); Y97(1.07)  LDD0292  [10]
 LDCM0022  KB02 Ramos C3(0.98)  LDD2182  [30]
 LDCM0023  KB03 MDA-MB-231 C3(1.64)  LDD1701  [29]
 LDCM0024  KB05 Ramos C3(0.84)  LDD2185  [30]
 LDCM0030  Luteolin HEK-293T 9.68  LDD0182  [9]
 LDCM0109  NEM HeLa H58(0.00); H66(0.00)  LDD0223  [13]
 LDCM0032  Oleacein HEK-293T 4.33  LDD0184  [9]
 LDCM0628  OTUB2-COV-1 HEK-293T C3(0.48)  LDD2207  [31]

The Interaction Atlas With This Target

The Drug(s) Related To This Target

Approved
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Cupric Chloride . DB09131

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Comparison of Different Competitive Proteome Profiling Approaches in Target Identification of Covalent Inhibitors. Chembiochem. 2022 Dec 16;23(24):e202200389. doi: 10.1002/cbic.202200389. Epub 2022 Nov 22.
3 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.
4 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
5 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
6 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
7 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
8 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
9 A chemical probe unravels the reactive proteome of health-associated catechols. Chem Sci. 2023 Jul 22;14(32):8635-8643. doi: 10.1039/d3sc00888f. eCollection 2023 Aug 16.
Mass spectrometry data entry: PXD043348
10 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
11 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
12 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
13 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
14 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
15 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
16 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
17 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
18 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
19 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
20 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
21 Global profiling of phosphorylation-dependent changes in cysteine reactivity. Nat Methods. 2022 Mar;19(3):341-352. doi: 10.1038/s41592-022-01398-2. Epub 2022 Feb 28.
Mass spectrometry data entry: PXD026730
22 Site-Specific Activity-Based Protein Profiling Using Phosphonate Handles. Mol Cell Proteomics. 2023 Jan;22(1):100455. doi: 10.1016/j.mcpro.2022.100455. Epub 2022 Nov 24.
Mass spectrometry data entry: PXD036569
23 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
24 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
25 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
26 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
27 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
28 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
29 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
30 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
31 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.