Details of the Target

General Information of Target

Target ID LDTP13626
Target Name Ubiquilin-1 (UBQLN1)
Gene Name UBQLN1
Gene ID 29979
Synonyms
DA41; PLIC1; Ubiquilin-1; Protein linking IAP with cytoskeleton 1; PLIC-1; hPLIC-1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSKAFGLLRQICQSILAESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNI
GQTCCLNSLIQVFVMNVDFTRILKRITVPRGADEQRRSVPFQMLLLLEKMQDSRQKAVRP
LELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVHLVERLQALYTIRVKDSLICVD
CAMESSRNSSMLTLPLSLFDVDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGK
QVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGG
QYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWQE
TAYLLVYMKMEC
Target Bioclass
Other
Subcellular location
Cytoplasm
Function
Plays an important role in the regulation of different protein degradation mechanisms and pathways including ubiquitin-proteasome system (UPS), autophagy and endoplasmic reticulum-associated protein degradation (ERAD) pathway. Mediates the proteasomal targeting of misfolded or accumulated proteins for degradation by binding (via UBA domain) to their polyubiquitin chains and by interacting (via ubiquitin-like domain) with the subunits of the proteasome. Plays a role in the ERAD pathway via its interaction with ER-localized proteins UBXN4, VCP and HERPUD1 and may form a link between the polyubiquitinated ERAD substrates and the proteasome. Involved in the regulation of macroautophagy and autophagosome formation; required for maturation of autophagy-related protein LC3 from the cytosolic form LC3-I to the membrane-bound form LC3-II and may assist in the maturation of autophagosomes to autolysosomes by mediating autophagosome-lysosome fusion. Negatively regulates the TICAM1/TRIF-dependent toll-like receptor signaling pathway by decreasing the abundance of TICAM1 via the autophagic pathway. Promotes the ubiquitination and lysosomal degradation of ORAI1, consequently down-regulating the ORAI1-mediated Ca2+ mobilization. Suppresses the maturation and proteasomal degradation of amyloid beta A4 protein (A4) by stimulating the lysine 63 (K63)-linked polyubiquitination. Delays the maturation of A4 by sequestering it in the Golgi apparatus and preventing its transport to the cell surface for subsequent processing. Ubiquitinates BCL2L10 and thereby stabilizes protein abundance.; [Isoform 1]: Plays a role in unfolded protein response (UPR) by attenuating the induction of UPR-inducible genes, DDTI3/CHOP, HSPA5 and PDIA2 during ER stress. Plays a key role in the regulation of the levels of PSEN1 by targeting its accumulation to aggresomes which may then be removed from cells by autophagocytosis.; [Isoform 2]: Plays a role in unfolded protein response (UPR) by attenuating the induction of UPR-inducible genes, DDTI3/CHOP, HSPA5 and PDIA2 during ER stress.; [Isoform 3]: Plays a role in unfolded protein response (UPR) by attenuating the induction of UPR-inducible genes, DDTI3/CHOP, HSPA5 and PDIA2 during ER stress. Plays a key role in the regulation of the levels of PSEN1 by targeting its accumulation to aggresomes which may then be removed from cells by autophagocytosis.
Uniprot ID
Q9UMX0
Ensemble ID
ENST00000257468.11
HGNC ID
HGNC:12508

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CAL148 SNV: p.N136S .
HCT15 SNV: p.F372L .
IGROV1 SNV: p.M404I .
NCIH1048 SNV: p.S130P .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 18 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
AZ-9
 Probe Info  		8.42  LDD0393  [1]
Jackson_1
 Probe Info  		20.00  LDD0122  [2]
TH211
 Probe Info  		Y276(20.00); Y269(10.73)  LDD0257  [3]
TH214
 Probe Info  		Y269(11.72)  LDD0258  [3]
TH216
 Probe Info  		Y269(15.22)  LDD0259  [3]
STPyne
 Probe Info  		K42(10.00); K45(0.20)  LDD0277  [4]
ONAyne
 Probe Info  		K42(10.00)  LDD0275  [4]
HHS-482
 Probe Info  		Y269(0.85)  LDD0285  [5]
HHS-475
 Probe Info  		Y276(0.57); Y269(0.93)  LDD0264  [6]
HHS-465
 Probe Info  		Y269(9.16)  LDD2237  [7]
5E-2FA
 Probe Info  		H72(0.00); H227(0.00)  LDD2235  [8]
ATP probe
 Probe Info  		K47(0.00); K70(0.00)  LDD0199  [9]
m-APA
 Probe Info  		H227(0.00); H72(0.00); H97(0.00); H94(0.00)  LDD2231  [8]
ATP probe
 Probe Info  		N.A.  LDD0035  [10]
NHS
 Probe Info  		N.A.  LDD0010  [11]
SF
 Probe Info  		N.A.  LDD0028  [12]
1d-yne
 Probe Info  		N.A.  LDD0357  [13]
Acrolein
 Probe Info  		N.A.  LDD0217  [14]
PAL-AfBPP Probe
Click To Hide/Show 14 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C027
 Probe Info  		5.39  LDD1733  [15]
C092
 Probe Info  		17.75  LDD1783  [15]
C094
 Probe Info  		41.07  LDD1785  [15]
C313
 Probe Info  		12.21  LDD1980  [15]
C362
 Probe Info  		28.05  LDD2023  [15]
FFF probe11
 Probe Info  		20.00  LDD0471  [16]
FFF probe12
 Probe Info  		12.37  LDD0473  [16]
FFF probe13
 Probe Info  		20.00  LDD0475  [16]
FFF probe14
 Probe Info  		20.00  LDD0477  [16]
FFF probe2
 Probe Info  		20.00  LDD0463  [16]
FFF probe3
 Probe Info  		20.00  LDD0464  [16]
FFF probe4
 Probe Info  		20.00  LDD0466  [16]
JN0003
 Probe Info  		20.00  LDD0469  [16]
OEA-DA
 Probe Info  		9.71  LDD0046  [17]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0116  HHS-0101 DM93 Y276(0.57); Y269(0.93)  LDD0264  [6]
 LDCM0117  HHS-0201 DM93 Y269(0.85); Y276(1.00)  LDD0265  [6]
 LDCM0118  HHS-0301 DM93 Y269(0.84); Y276(0.96)  LDD0266  [6]
 LDCM0119  HHS-0401 DM93 Y269(0.94); Y276(1.46)  LDD0267  [6]
 LDCM0120  HHS-0701 DM93 Y269(1.09); Y276(1.48)  LDD0268  [6]
 LDCM0107  IAA HeLa N.A.  LDD0221  [14]
 LDCM0123  JWB131 DM93 Y269(0.85)  LDD0285  [5]
 LDCM0124  JWB142 DM93 Y269(0.66)  LDD0286  [5]
 LDCM0125  JWB146 DM93 Y269(1.08)  LDD0287  [5]
 LDCM0126  JWB150 DM93 Y269(2.37)  LDD0288  [5]
 LDCM0127  JWB152 DM93 Y269(2.04)  LDD0289  [5]
 LDCM0128  JWB198 DM93 Y269(1.04)  LDD0290  [5]
 LDCM0129  JWB202 DM93 Y269(0.56)  LDD0291  [5]
 LDCM0130  JWB211 DM93 Y269(0.94)  LDD0292  [5]
 LDCM0109  NEM HeLa N.A.  LDD0223  [14]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 50 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon (AGPAT5) 1-acyl-sn-glycerol-3-phosphate acyltransferase family Q9NUQ2
5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 5'-AMP-activated protein kinase beta subunit family O43741
Anterior gradient protein 2 homolog (AGR2) AGR family O95994
Anterior gradient protein 3 (AGR3) AGR family Q8TD06
DNA-directed RNA polymerases I and III subunit RPAC2 (POLR1D) Archaeal Rpo11/eukaryotic RPB11/RPC19 RNA polymerase subunit family P0DPB6
DNA-directed RNA polymerases I, II, and III subunit RPABC1 (POLR2E) Archaeal Rpo5/eukaryotic RPB5 RNA polymerase subunit family P19388
Phosphatidate cytidylyltransferase 2 (CDS2) CDS family O95674
Ethanolamine kinase 1 (ETNK1) Choline/ethanolamine kinase family Q9HBU6
Catechol O-methyltransferase domain-containing protein 1 (COMTD1) Cation-dependent O-methyltransferase family Q86VU5
Extracellular superoxide dismutase [Cu-Zn] (SOD3) Cu-Zn superoxide dismutase family P08294
Peptidyl-prolyl cis-trans isomerase C (PPIC) Cyclophilin-type PPIase family P45877
Peptidyl-prolyl cis-trans isomerase B (PPIB) Cyclophilin-type PPIase family P23284
Desumoylating isopeptidase 1 (DESI1) DeSI family Q6ICB0
Bifunctional polynucleotide phosphatase/kinase (PNKP) DNA 3' phosphatase family Q96T60
Peptidyl-prolyl cis-trans isomerase FKBP2 (FKBP2) FKBP-type PPIase family P26885
Amine oxidase [flavin-containing] B (MAOB) Flavin monoamine oxidase family P27338
NADH-cytochrome b5 reductase 1 (CYB5R1) Flavoprotein pyridine nucleotide cytochrome reductase family Q9UHQ9
Glutathione peroxidase 3 (GPX3) Glutathione peroxidase family P22352
Procollagen galactosyltransferase 2 (COLGALT2) Glycosyltransferase 25 family Q8IYK4
Phospholipase A and acyltransferase 1 (PLAAT1) H-rev107 family Q9HDD0
Phospholipase A and acyltransferase 2 (PLAAT2) H-rev107 family Q9NWW9
Phospholipase A and acyltransferase 3 (PLAAT3) H-rev107 family P53816
Hexokinase-2 (HK2) Hexokinase family P52789
Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1) ITPRIP family Q6GPH6
Kappa-casein (CSN3) Kappa-casein family P07498
DNA replication licensing factor MCM7 (MCM7) MCM family P33993
Dihydropyrimidinase (DPYS) Hydantoinase/dihydropyrimidinase family Q14117
Dihydropyrimidinase-related protein 5 (DPYSL5) Hydantoinase/dihydropyrimidinase family Q9BPU6
NADPH-dependent diflavin oxidoreductase 1 (NDOR1) NADPH-dependent diflavin oxidoreductase NDOR1 family; Flavodoxin family; Flavoprotein pyridine nucleotide cytochrome reductase family Q9UHB4
Nucleoside diphosphate kinase 3 (NME3) NDK family Q13232
ATP-dependent (S)-NAD(P)H-hydrate dehydratase (NAXD) NnrD/CARKD family Q8IW45
26S proteasome non-ATPase regulatory subunit 4 (PSMD4) Proteasome subunit S5A family P55036
Endoplasmic reticulum resident protein 27 (ERP27) Protein disulfide isomerase family Q96DN0
Dual specificity protein phosphatase 10 (DUSP10) Protein-tyrosine phosphatase family Q9Y6W6
Pyruvate kinase PKM (PKM) Pyruvate kinase family P14618
Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma (PDE6H) Rod/cone cGMP-PDE gamma subunit family Q13956
Very-long-chain 3-oxoacyl-CoA reductase (HSD17B12) Short-chain dehydrogenases/reductases (SDR) family Q53GQ0
E3 ubiquitin-protein ligase TRIM23 (TRIM23) Arf family P36406
GTP-binding protein Rheb (RHEB) Rheb family Q15382
Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase (NGLY1) PNGase family Q96IV0
E3 ubiquitin-protein ligase TRIM32 (TRIM32) TRIM/RBCC family Q13049
Ubiquitin-conjugating enzyme E2 A (UBE2A) Ubiquitin-conjugating enzyme family P49459
Ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1) Ubiquitin-conjugating enzyme family Q13404
Ataxin-3 (ATXN3) . P54252
Cytosolic acyl coenzyme A thioester hydrolase (ACOT7) . O00154
E3 ubiquitin-protein ligase PPP1R11 (PPP1R11) . O60927
E3 ubiquitin-protein ligase RNF4 (RNF4) . P78317
Phosphoinositide-3-kinase-interacting protein 1 (PIK3IP1) . Q96FE7
RING finger protein 208 (RNF208) . Q9H0X6
Thioredoxin domain-containing protein 12 (TXNDC12) . O95881
Transporter and channel
Click To Hide/Show 16 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Defensin-6 (DEFA6) Alpha-defensin family Q01524
Amyloid-beta precursor protein (APP) APP family P05067
Gamma-aminobutyric acid receptor subunit delta (GABRD) Ligand-gated ion channel family O14764
Monocarboxylate transporter 4 (SLC16A3) Monocarboxylate porter (TC 2.A.1.13) family O15427
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
Nuclear RNA export factor 1 (NXF1) NXF family Q9UBU9
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (RPN1) OST1 family P04843
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 (OST4) OST4 family P0C6T2
Transmembrane protein 258 (TMEM258) OST5 family P61165
Mitochondrial import inner membrane translocase subunit Tim17-B (TIMM17B) Tim17/Tim22/Tim23 family O60830
SH3 and cysteine-rich domain-containing protein (STAC) . Q99469
Small integral membrane protein 2 (SMIM2) . Q9BVW6
Stromal interaction molecule 1 (STIM1) . Q13586
Transmembrane protein 31 (TMEM31) . Q5JXX7
Ubiquilin-4 (UBQLN4) . Q9NRR5
Uncharacterized protein CXorf38 (CXorf38) . Q8TB03
Transcription factor
Click To Hide/Show 23 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Fos-related antigen 2 (FOSL2) BZIP family P15408
Transcription factor Jun (JUN) BZIP family P05412
Homeobox protein DLX-3 (DLX3) Distal-less homeobox family O60479
Transcription factor E2F8 (E2F8) E2F/DP family A0AVK6
Zinc finger and BTB domain-containing protein 14 (ZBTB14) Krueppel C2H2-type zinc-finger protein family O43829
Zinc finger protein 296 (ZNF296) Krueppel C2H2-type zinc-finger protein family Q8WUU4
Zinc finger protein 343 (ZNF343) Krueppel C2H2-type zinc-finger protein family Q6P1L6
Nuclear receptor subfamily 1 group D member 2 (NR1D2) Nuclear hormone receptor family Q14995
TSC22 domain family protein 4 (TSC22D4) TSC-22/Dip/Bun family Q9Y3Q8
Achaete-scute homolog 1 (ASCL1) . P50553
Achaete-scute homolog 4 (ASCL4) . Q6XD76
Deoxynucleotidyltransferase terminal-interacting protein 1 (DNTTIP1) . Q9H147
Golgin-45 (BLZF1) . Q9H2G9
LIM/homeobox protein Lhx5 (LHX5) . Q9H2C1
LIM/homeobox protein Lhx8 (LHX8) . Q68G74
Myc proto-oncogene protein (MYC) . P01106
Protein AF-17 (MLLT6) . P55198
T-box transcription factor TBX6 (TBX6) . O95947
THAP domain-containing protein 3 (THAP3) . Q8WTV1
Transcription factor p65 (RELA) . Q04206
Upstream stimulatory factor 1 (USF1) . P22415
Zinc finger and BTB domain-containing protein 8B (ZBTB8B) . Q8NAP8
Zinc finger MYM-type protein 4 (ZMYM4) . Q5VZL5
GPCR
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable G-protein coupled receptor 162 (GPR162) G-protein coupled receptor 1 family Q16538
Metabotropic glutamate receptor 2 (GRM2) G-protein coupled receptor 3 family Q14416
Frizzled-7 (FZD7) G-protein coupled receptor Fz/Smo family O75084
Immunoglobulin
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Leukocyte-associated immunoglobulin-like receptor 2 (LAIR2) . Q6ISS4
Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A) . P12318
Cytokine and receptor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Interleukin-37 (IL37) IL-1 family Q9NZH6
C-C motif chemokine 3 (CCL3) Intercrine beta (chemokine CC) family P10147
C-C motif chemokine 7 (CCL7) Intercrine beta (chemokine CC) family P80098
Other
Click To Hide/Show 130 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Neuroendocrine protein 7B2 (SCG5) 7B2 family P05408
Drebrin-like protein (DBNL) ABP1 family Q9UJU6
Proteasomal ubiquitin receptor ADRM1 (ADRM1) ADRM1 family Q16186
Apolipoprotein C-IV (APOC4) Apolipoprotein C4 family P55056
Beta-defensin 115 (DEFB115) Beta-defensin family Q30KQ5
BPI fold-containing family A member 1 (BPIFA1) Plunc family Q9NP55
Neutrophil gelatinase-associated lipocalin (LCN2) Lipocalin family P80188
CD99 antigen-like protein 2 (CD99L2) CD99 family Q8TCZ2
Cyclin-dependent kinase inhibitor 1 (CDKN1A) CDI family P38936
Cell death-inducing p53-target protein 1 (CDIP1) CDIP1/LITAF family Q9H305
Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF) CDIP1/LITAF family Q99732
Secretogranin-2 (SCG2) Chromogranin/secretogranin protein family P13521
Calumenin (CALU) CREC family O43852
Cancer/testis antigen 1 (CTAG1A; CTAG1B) CTAG/PCC1 family P78358
Cancer/testis antigen 2 (CTAG2) CTAG/PCC1 family O75638
Neuroblastoma suppressor of tumorigenicity 1 (NBL1) DAN family P41271
Sister chromatid cohesion protein DCC1 (DSCC1) DCC1 family Q9BVC3
Dermokine (DMKN) Dermokine family Q6E0U4
Dexamethasone-induced protein (DEXI) DEXI family O95424
Putative elongation factor 1-delta-like protein (EEF1DP3) EF-1-beta/EF-1-delta family Q658K8
RNA polymerase II elongation factor ELL2 (ELL2) ELL/occludin family O00472
Epithelial splicing regulatory protein 1 (ESRP1) ESRP family Q6NXG1
Large ribosomal subunit protein eL31 (RPL31) Eukaryotic ribosomal protein eL31 family P62899
Retrotransposon Gag-like protein 8A (RTL8A) FAM127 family Q9BWD3
Retrotransposon Gag-like protein 8B (RTL8B) FAM127 family Q17RB0
Retrotransposon Gag-like protein 8C (RTL8C) FAM127 family A6ZKI3
Protein FAM163A (FAM163A) FAM163 family Q96GL9
Protein FAM163B (FAM163B) FAM163 family P0C2L3
Protein FAM184A (FAM184A) FAM184 family Q8NB25
Protein FAM83A (FAM83A) FAM83 family Q86UY5
Collagen alpha-2(IX) chain (COL9A2) Fibril-associated collagens with interrupted helices (FACIT) family Q14055
Collagen alpha-2(I) chain (COL1A2) Fibrillar collagen family P08123
EGF-containing fibulin-like extracellular matrix protein 2 (EFEMP2) Fibulin family O95967
Folate receptor gamma (FOLR3) Folate receptor family P41439
Galanin peptides (GAL) Galanin family P22466
Glycophorin-B (GYPB) Glycophorin-A family P06028
Guanylate cyclase activator 2B (GUCA2B) Guanylin family Q16661
Guanylin (GUCA2A) Guanylin family Q02747
Heat shock 70 kDa protein 13 (HSPA13) Heat shock protein 70 family P48723
Protein HID1 (HID1) Hid-1 family Q8IV36
IST1 homolog (IST1) IST1 family P53990
Zymogen granule membrane protein 16 (ZG16) Jacalin lectin family O60844
Junctophilin-4 (JPH4) Junctophilin family Q96JJ6
Keratin-associated protein 8-1 (KRTAP8-1) KRTAP type 8 family Q8IUC2
Ragulator complex protein LAMTOR1 (LAMTOR1) LAMTOR1 family Q6IAA8
Protein PALS1 (PALS1) MAGUK family Q8N3R9
LRP chaperone MESD (MESD) MESD family Q14696
Mitochondrial dynamics protein MID49 (MIEF2) MID49/MID51 family Q96C03
Appetite-regulating hormone (GHRL) Motilin family Q9UBU3
Myeloid-derived growth factor (MYDGF) MYDGF family Q969H8
Natriuretic peptides A (NPPA) Natriuretic peptide family P01160
Nuclear distribution protein nudE-like 1 (NDEL1) NudE family Q9GZM8
Proteasome activator complex subunit 1 (PSME1) PA28 family Q06323
Midkine (MDK) Pleiotrophin family P21741
Paraneoplastic antigen Ma1 (PNMA1) PNMA family Q8ND90
Submaxillary gland androgen-regulated protein 3B (SMR3B) PROL1/PROL3 family P02814
26S proteasome non-ATPase regulatory subunit 6 (PSMD6) Proteasome subunit S10 family Q15008
Polycomb protein SCMH1 (SCMH1) SCM family Q96GD3
Serglycin (SRGN) Serglycin family P10124
Plasminogen activator inhibitor 1 (SERPINE1) Serpin family P05121
Serpin I2 (SERPINI2) Serpin family O75830
Nucleotide exchange factor SIL1 (SIL1) SIL1 family Q9H173
Mitochondrial dynamics protein MIEF1 (MIEF1) SMCR7 family Q9NQG6
Small integral membrane protein 19 (SMIM19) SMIM19 family Q96E16
Charged multivesicular body protein 7 (CHMP7) SNF7 family Q8WUX9
SNW domain-containing protein 1 (SNW1) SNW family Q13573
Protein sprouty homolog 4 (SPRY4) Sprouty family Q9C004
Signal transducing adapter molecule 2 (STAM2) STAM family O75886
Synembryn-A (RIC8A) Synembryn family Q9NPQ8
CST complex subunit TEN1 (TEN1) TEN1 family Q86WV5
Tetraspanin-2 (TSPAN2) Tetraspanin (TM4SF) family O60636
Transmembrane protein 186 (TMEM186) TMEM186 family Q96B77
Ubiquitin-ribosomal protein eL40 fusion protein (UBA52) Ubiquitin family; Eukaryotic ribosomal protein eL40 family P62987
Ubiquitin-ribosomal protein eS31 fusion protein (RPS27A) Ubiquitin family; Eukaryotic ribosomal protein eS31 family P62979
Small ribosomal subunit protein uS14m (MRPS14) Universal ribosomal protein uS14 family O60783
Protein MANBAL (MANBAL) UPF0239 family Q9NQG1
Protein Wnt-7a (WNT7A) Wnt family O00755
Immediate early response 3-interacting protein 1 (IER3IP1) YOS1 family Q9Y5U9
AN1-type zinc finger protein 2B (ZFAND2B) . Q8WV99
Anosmin-1 (ANOS1) . P23352
Antileukoproteinase (SLPI) . P03973
Bromo adjacent homology domain-containing 1 protein (BAHD1) . Q8TBE0
Brorin (VWC2) . Q2TAL6
BTB/POZ domain-containing protein KCTD17 (KCTD17) . Q8N5Z5
Cleavage stimulation factor subunit 2 (CSTF2) . P33240
Cleavage stimulation factor subunit 2 tau variant (CSTF2T) . Q9H0L4
Collagen alpha-1(X) chain (COL10A1) . Q03692
Complement C1q tumor necrosis factor-related protein 2 (C1QTNF2) . Q9BXJ5
Complement C1q tumor necrosis factor-related protein 4 (C1QTNF4) . Q9BXJ3
DAZ-associated protein 2 (DAZAP2) . Q15038
Developmental pluripotency-associated protein 2 (DPPA2) . Q7Z7J5
Endoplasmic reticulum resident protein 29 (ERP29) . P30040
Epidermal growth factor receptor substrate 15 (EPS15) . P42566
Extracellular matrix protein 1 (ECM1) . Q16610
Fibronectin (FN1) . P02751
Insulin-like growth factor-binding protein 6 (IGFBP6) . P24592
Junctional sarcoplasmic reticulum protein 1 (JSRP1) . Q96MG2
Kelch-like protein 42 (KLHL42) . Q9P2K6
Laminin subunit beta-1 (LAMB1) . P07942
Outer dynein arm-docking complex subunit 3 (ODAD3) . A5D8V7
Period circadian protein homolog 1 (PER1) . O15534
Pleckstrin homology domain-containing family G member 7 (PLEKHG7) . Q6ZR37
Pre-B-cell leukemia transcription factor-interacting protein 1 (PBXIP1) . Q96AQ6
Proline-rich acidic protein 1 (PRAP1) . Q96NZ9
Proline-rich protein 4 (PRR4) . Q16378
Protein phosphatase 1 regulatory subunit 16A (PPP1R16A) . Q96I34
Protocadherin-18 (PCDH18) . Q9HCL0
Psoriasis susceptibility 1 candidate gene 2 protein (PSORS1C2) . Q9UIG4
Putative uncharacterized protein encoded by LINC00518 (LINC00518) . Q8N0U6
Retinoic acid-induced protein 2 (RAI2) . Q9Y5P3
Spermatogenesis-associated protein 12 (SPATA12) . Q7Z6I5
Spermatogenesis-associated serine-rich protein 1 (SPATS1) . Q496A3
Suppressor of cytokine signaling 6 (SOCS6) . O14544
Telethonin (TCAP) . O15273
Testis-expressed protein 12 (TEX12) . Q9BXU0
Tetratricopeptide repeat protein 23-like (TTC23L) . Q6PF05
Transmembrane and coiled-coil domain-containing protein 6 (TMCO6) . Q96DC7
Transmembrane and ubiquitin-like domain-containing protein 2 (TMUB2) . Q71RG4
Transmembrane protein 61 (TMEM61) . Q8N0U2
Trefoil factor 1 (TFF1) . P04155
Ubiquilin-1 (UBQLN1) . Q9UMX0
Ubiquilin-2 (UBQLN2) . Q9UHD9
UBX domain-containing protein 1 (UBXN1) . Q04323
UBX domain-containing protein 4 (UBXN4) . Q92575
UBX domain-containing protein 7 (UBXN7) . O94888
Uncharacterized protein C3orf36 (C3orf36) . Q3SXR2
Uncharacterized protein IRF1-AS1 (IRF1-AS1) . Q8N8D9
WAP four-disulfide core domain protein 12 (WFDC12) . Q8WWY7
WW domain binding protein 1-like (WBP1L) . Q9NX94
Zinc finger CCHC domain-containing protein 17 (ZCCHC17) . Q9NP64

References

1 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
2 Appendage and Scaffold Diverse Fully Functionalized Small-Molecule Probes via a Minimalist Terminal Alkyne-Aliphatic Diazirine Isocyanide. J Org Chem. 2018 Sep 21;83(18):11245-11253. doi: 10.1021/acs.joc.8b01831. Epub 2018 Aug 31.
3 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
4 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
5 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
6 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
7 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
8 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
9 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
10 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
11 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
12 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
13 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
14 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
15 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
16 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
17 Mapping Protein Targets of Bioactive Small Molecules Using Lipid-Based Chemical Proteomics. ACS Chem Biol. 2017 Oct 20;12(10):2671-2681. doi: 10.1021/acschembio.7b00581. Epub 2017 Sep 20.
Mass spectrometry data entry: PXD007570