Details of the Target
General Information of Target
| Target ID | LDTP13626 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ubiquilin-1 (UBQLN1) | |||||
| Gene Name | UBQLN1 | |||||
| Gene ID | 29979 | |||||
| Synonyms |
DA41; PLIC1; Ubiquilin-1; Protein linking IAP with cytoskeleton 1; PLIC-1; hPLIC-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MSKAFGLLRQICQSILAESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNI
GQTCCLNSLIQVFVMNVDFTRILKRITVPRGADEQRRSVPFQMLLLLEKMQDSRQKAVRP LELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVHLVERLQALYTIRVKDSLICVD CAMESSRNSSMLTLPLSLFDVDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGK QVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGG QYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWQE TAYLLVYMKMEC |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Plays an important role in the regulation of different protein degradation mechanisms and pathways including ubiquitin-proteasome system (UPS), autophagy and endoplasmic reticulum-associated protein degradation (ERAD) pathway. Mediates the proteasomal targeting of misfolded or accumulated proteins for degradation by binding (via UBA domain) to their polyubiquitin chains and by interacting (via ubiquitin-like domain) with the subunits of the proteasome. Plays a role in the ERAD pathway via its interaction with ER-localized proteins UBXN4, VCP and HERPUD1 and may form a link between the polyubiquitinated ERAD substrates and the proteasome. Involved in the regulation of macroautophagy and autophagosome formation; required for maturation of autophagy-related protein LC3 from the cytosolic form LC3-I to the membrane-bound form LC3-II and may assist in the maturation of autophagosomes to autolysosomes by mediating autophagosome-lysosome fusion. Negatively regulates the TICAM1/TRIF-dependent toll-like receptor signaling pathway by decreasing the abundance of TICAM1 via the autophagic pathway. Promotes the ubiquitination and lysosomal degradation of ORAI1, consequently down-regulating the ORAI1-mediated Ca2+ mobilization. Suppresses the maturation and proteasomal degradation of amyloid beta A4 protein (A4) by stimulating the lysine 63 (K63)-linked polyubiquitination. Delays the maturation of A4 by sequestering it in the Golgi apparatus and preventing its transport to the cell surface for subsequent processing. Ubiquitinates BCL2L10 and thereby stabilizes protein abundance.; [Isoform 1]: Plays a role in unfolded protein response (UPR) by attenuating the induction of UPR-inducible genes, DDTI3/CHOP, HSPA5 and PDIA2 during ER stress. Plays a key role in the regulation of the levels of PSEN1 by targeting its accumulation to aggresomes which may then be removed from cells by autophagocytosis.; [Isoform 2]: Plays a role in unfolded protein response (UPR) by attenuating the induction of UPR-inducible genes, DDTI3/CHOP, HSPA5 and PDIA2 during ER stress.; [Isoform 3]: Plays a role in unfolded protein response (UPR) by attenuating the induction of UPR-inducible genes, DDTI3/CHOP, HSPA5 and PDIA2 during ER stress. Plays a key role in the regulation of the levels of PSEN1 by targeting its accumulation to aggresomes which may then be removed from cells by autophagocytosis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AZ-9 Probe Info |
![]() |
8.42 | LDD0393 | [1] | |
|
Jackson_1 Probe Info |
![]() |
20.00 | LDD0122 | [2] | |
|
TH211 Probe Info |
![]() |
Y276(20.00); Y269(10.73) | LDD0257 | [3] | |
|
TH214 Probe Info |
![]() |
Y269(11.72) | LDD0258 | [3] | |
|
TH216 Probe Info |
![]() |
Y269(15.22) | LDD0259 | [3] | |
|
STPyne Probe Info |
![]() |
K42(10.00); K45(0.20) | LDD0277 | [4] | |
|
ONAyne Probe Info |
![]() |
K42(10.00) | LDD0275 | [4] | |
|
HHS-482 Probe Info |
![]() |
Y269(0.85) | LDD0285 | [5] | |
|
HHS-475 Probe Info |
![]() |
Y276(0.57); Y269(0.93) | LDD0264 | [6] | |
|
HHS-465 Probe Info |
![]() |
Y269(9.16) | LDD2237 | [7] | |
|
5E-2FA Probe Info |
![]() |
H72(0.00); H227(0.00) | LDD2235 | [8] | |
|
ATP probe Probe Info |
![]() |
K47(0.00); K70(0.00) | LDD0199 | [9] | |
|
m-APA Probe Info |
![]() |
H227(0.00); H72(0.00); H97(0.00); H94(0.00) | LDD2231 | [8] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0035 | [10] | |
|
NHS Probe Info |
![]() |
N.A. | LDD0010 | [11] | |
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [12] | |
|
1d-yne Probe Info |
![]() |
N.A. | LDD0357 | [13] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [14] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C027 Probe Info |
![]() |
5.39 | LDD1733 | [15] | |
|
C092 Probe Info |
![]() |
17.75 | LDD1783 | [15] | |
|
C094 Probe Info |
![]() |
41.07 | LDD1785 | [15] | |
|
C313 Probe Info |
![]() |
12.21 | LDD1980 | [15] | |
|
C362 Probe Info |
![]() |
28.05 | LDD2023 | [15] | |
|
FFF probe11 Probe Info |
![]() |
20.00 | LDD0471 | [16] | |
|
FFF probe12 Probe Info |
![]() |
12.37 | LDD0473 | [16] | |
|
FFF probe13 Probe Info |
![]() |
20.00 | LDD0475 | [16] | |
|
FFF probe14 Probe Info |
![]() |
20.00 | LDD0477 | [16] | |
|
FFF probe2 Probe Info |
![]() |
20.00 | LDD0463 | [16] | |
|
FFF probe3 Probe Info |
![]() |
20.00 | LDD0464 | [16] | |
|
FFF probe4 Probe Info |
![]() |
20.00 | LDD0466 | [16] | |
|
JN0003 Probe Info |
![]() |
20.00 | LDD0469 | [16] | |
|
OEA-DA Probe Info |
![]() |
9.71 | LDD0046 | [17] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0116 | HHS-0101 | DM93 | Y276(0.57); Y269(0.93) | LDD0264 | [6] |
| LDCM0117 | HHS-0201 | DM93 | Y269(0.85); Y276(1.00) | LDD0265 | [6] |
| LDCM0118 | HHS-0301 | DM93 | Y269(0.84); Y276(0.96) | LDD0266 | [6] |
| LDCM0119 | HHS-0401 | DM93 | Y269(0.94); Y276(1.46) | LDD0267 | [6] |
| LDCM0120 | HHS-0701 | DM93 | Y269(1.09); Y276(1.48) | LDD0268 | [6] |
| LDCM0107 | IAA | HeLa | N.A. | LDD0221 | [14] |
| LDCM0123 | JWB131 | DM93 | Y269(0.85) | LDD0285 | [5] |
| LDCM0124 | JWB142 | DM93 | Y269(0.66) | LDD0286 | [5] |
| LDCM0125 | JWB146 | DM93 | Y269(1.08) | LDD0287 | [5] |
| LDCM0126 | JWB150 | DM93 | Y269(2.37) | LDD0288 | [5] |
| LDCM0127 | JWB152 | DM93 | Y269(2.04) | LDD0289 | [5] |
| LDCM0128 | JWB198 | DM93 | Y269(1.04) | LDD0290 | [5] |
| LDCM0129 | JWB202 | DM93 | Y269(0.56) | LDD0291 | [5] |
| LDCM0130 | JWB211 | DM93 | Y269(0.94) | LDD0292 | [5] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0223 | [14] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Transcription factor
GPCR
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Leukocyte-associated immunoglobulin-like receptor 2 (LAIR2) | . | Q6ISS4 | |||
| Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A) | . | P12318 | |||
Cytokine and receptor
Other
References
































