Details of the Target
General Information of Target
| Target ID | LDTP06198 | |||||
|---|---|---|---|---|---|---|
| Target Name | Major facilitator superfamily domain-containing protein 10 (MFSD10) | |||||
| Gene Name | MFSD10 | |||||
| Gene ID | 10227 | |||||
| Synonyms |
TETRAN; Major facilitator superfamily domain-containing protein 10; Tetracycline transporter-like protein |
|||||
| 3D Structure | ||||||
| Sequence |
MGWGGGGGCTPRPPIHQQPPERRVVTVVFLGLLLDLLAFTLLLPLLPGLLESHGRAHDPL
YGSWQGGVDWFATAIGMPVEKRYNSVLFGGLIGSAFSVLQFLCAPLTGATSDCLGRRPVM LLCLMGVATSYAVWATSRSFAAFLASRLIGGISKGNVSLSTAIVADLGSPLARSQGMAVI GVAFSLGFTLGPMLGASLPLEMAPWFALLFAASDLLFIFCFLPETLPLEKRAPSIALGFR DAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYFLYLFLFSGLEYTLSFLTHQR FQFSSLQQGKMFFLIGLTMATIQGAYARRIHPGGEVAAVKRALLLLVPAFLLIGWGRSLP VLGLGLLLYSFAAAVVVPCLSSVVAGYGSPGQKGTVMGTLRSLGALARAAGPLVAASVYW LAGAQACFTTWSGLFLLPFFLLQKLSYPAQTLKAE |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Major facilitator superfamily
|
|||||
| Subcellular location |
Nucleus inner membrane
|
|||||
| Function |
Probable organic anion transporter which may serve as a transporter for some non-steroidal anti-inflammatory drugs (NSAIDs) as well as other organic anions across the luminal membranes of renal proximal tubules at the final excretion step into the urine.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Acrolein Probe Info |
![]() |
N.A. | LDD0221 | [1] | |
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [2] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C027 Probe Info |
![]() |
22.16 | LDD1733 | [3] | |
|
C056 Probe Info |
![]() |
19.56 | LDD1753 | [3] | |
|
C070 Probe Info |
![]() |
9.99 | LDD1766 | [3] | |
|
C094 Probe Info |
![]() |
22.94 | LDD1785 | [3] | |
|
C158 Probe Info |
![]() |
44.94 | LDD1838 | [3] | |
|
C161 Probe Info |
![]() |
11.88 | LDD1841 | [3] | |
|
C169 Probe Info |
![]() |
21.41 | LDD1849 | [3] | |
|
C201 Probe Info |
![]() |
24.76 | LDD1877 | [3] | |
|
C269 Probe Info |
![]() |
8.88 | LDD1939 | [3] | |
|
C280 Probe Info |
![]() |
10.70 | LDD1950 | [3] | |
|
C282 Probe Info |
![]() |
21.86 | LDD1952 | [3] | |
|
C293 Probe Info |
![]() |
20.39 | LDD1963 | [3] | |
|
C296 Probe Info |
![]() |
15.03 | LDD1966 | [3] | |
|
C347 Probe Info |
![]() |
5.35 | LDD2008 | [3] | |
|
C361 Probe Info |
![]() |
24.59 | LDD2022 | [3] | |
|
C388 Probe Info |
![]() |
38.85 | LDD2047 | [3] | |
|
C396 Probe Info |
![]() |
5.21 | LDD2055 | [3] | |
|
C426 Probe Info |
![]() |
12.64 | LDD2081 | [3] | |
|
OEA-DA Probe Info |
![]() |
6.13 | LDD0046 | [4] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Kallikrein-6 (KLK6) | Peptidase S1 family | Q92876 | |||
| TGF-beta receptor type-2 (TGFBR2) | TKL Ser/Thr protein kinase family | P37173 | |||
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Platelet endothelial cell adhesion molecule (PECAM1) | . | P16284 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Chromobox protein homolog 5 (CBX5) | . | P45973 | |||
References





















