Details of the Target
General Information of Target
| Target ID | LDTP15000 | |||||
|---|---|---|---|---|---|---|
| Target Name | Solute carrier family 35 member F1 (SLC35F1) | |||||
| Gene Name | SLC35F1 | |||||
| Gene ID | 222553 | |||||
| Synonyms |
C6orf169; Solute carrier family 35 member F1 |
|||||
| 3D Structure | ||||||
| Sequence |
MENFSLLSISGPPISSSALSAFPDIMFSRATSLPDIAKTAVPTEASSPAQALPPQYQSII
VRQGIQNTALSPDCSLGDTQHGEKLRRNCTIYRPWFSPYSYFVCADKESQLEAYDFPEVQ QDEGKWDNCLSEDMAENICSSSSSPENTCPREATKKSRHGLDSITSQDILMASRWHPAQQ NGYKCVACCRMYPTLDFLKSHIKRGFREGFSCKVYYRKLKALWSKEQKARLGDRLSSGSC QAFNSPAEHLRQIGGEAYLCL |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
SLC35F solute transporter family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function | Putative solute transporter. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C194 Probe Info |
![]() |
8.51 | LDD1870 | [1] | |
|
C197 Probe Info |
![]() |
7.06 | LDD1873 | [1] | |
|
C198 Probe Info |
![]() |
9.71 | LDD1874 | [1] | |
|
C199 Probe Info |
![]() |
6.23 | LDD1875 | [1] | |
|
C229 Probe Info |
![]() |
19.97 | LDD1902 | [1] | |
|
C231 Probe Info |
![]() |
19.03 | LDD1904 | [1] | |
|
C232 Probe Info |
![]() |
36.00 | LDD1905 | [1] | |
|
C233 Probe Info |
![]() |
23.92 | LDD1906 | [1] | |
|
C235 Probe Info |
![]() |
34.54 | LDD1908 | [1] | |
|
C273 Probe Info |
![]() |
5.74 | LDD1943 | [1] | |
|
C277 Probe Info |
![]() |
9.99 | LDD1947 | [1] | |
|
C327 Probe Info |
![]() |
6.06 | LDD1991 | [1] | |
|
C328 Probe Info |
![]() |
8.34 | LDD1992 | [1] | |
|
C331 Probe Info |
![]() |
4.96 | LDD1994 | [1] | |
|
C333 Probe Info |
![]() |
8.63 | LDD1996 | [1] | |
|
C386 Probe Info |
![]() |
6.92 | LDD2045 | [1] | |
|
C389 Probe Info |
![]() |
5.86 | LDD2048 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Catechol O-methyltransferase (COMT) | Cation-dependent O-methyltransferase family | P21964 | |||
Transporter and channel

















