Details of the Target
General Information of Target
Target ID | LDTP14716 | |||||
---|---|---|---|---|---|---|
Target Name | ATP synthase subunit ATP5MJ, mitochondrial (ATP5MJ) | |||||
Gene Name | ATP5MJ | |||||
Gene ID | 9556 | |||||
Synonyms |
ATP5MPL; C14orf2; MP68; ATP synthase subunit ATP5MJ, mitochondrial; 6.8 kDa mitochondrial proteolipid protein; MLQ; ATP synthase membrane subunit 6.8PL |
|||||
3D Structure | ||||||
Sequence |
MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEEN
LTRKSASK |
|||||
Target Bioclass |
Other
|
|||||
Family |
Small mitochondrial proteolipid family
|
|||||
Subcellular location |
Mitochondrion membrane
|
|||||
Function |
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (Probable). Minor subunit required to maintain the ATP synthase population in the mitochondria.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K14(5.26); K49(6.08) | LDD0277 | [1] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0221 | [2] | |
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [2] | |
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [2] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C055 Probe Info |
![]() |
20.25 | LDD1752 | [3] | |
C056 Probe Info |
![]() |
33.59 | LDD1753 | [3] | |
C091 Probe Info |
![]() |
13.83 | LDD1782 | [3] | |
C092 Probe Info |
![]() |
25.46 | LDD1783 | [3] | |
C094 Probe Info |
![]() |
35.75 | LDD1785 | [3] | |
C106 Probe Info |
![]() |
18.90 | LDD1793 | [3] | |
C112 Probe Info |
![]() |
24.59 | LDD1799 | [3] | |
C210 Probe Info |
![]() |
59.71 | LDD1884 | [3] | |
C231 Probe Info |
![]() |
22.94 | LDD1904 | [3] | |
C232 Probe Info |
![]() |
46.85 | LDD1905 | [3] | |
C235 Probe Info |
![]() |
29.65 | LDD1908 | [3] | |
C285 Probe Info |
![]() |
20.68 | LDD1955 | [3] | |
C289 Probe Info |
![]() |
35.75 | LDD1959 | [3] | |
C293 Probe Info |
![]() |
18.00 | LDD1963 | [3] | |
C296 Probe Info |
![]() |
11.88 | LDD1966 | [3] | |
C314 Probe Info |
![]() |
16.00 | LDD1981 | [3] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Mitochondrial carrier homolog 2 (MTCH2) | Mitochondrial carrier (TC 2.A.29) family | Q9Y6C9 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Apolipoprotein C-I (APOC1) | Apolipoprotein C1 family | P02654 | |||
Lipid transferase CIDEB (CIDEB) | CIDE family | Q9UHD4 |
References