General Information of Target

Target ID LDTP01913
Target Name HLA class I histocompatibility antigen, B alpha chain (HLA-B)
Gene Name HLA-B
Gene ID 3106
Synonyms
HLAB; HLA class I histocompatibility antigen, B alpha chain; Human leukocyte antigen B; HLA-B
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQ
SMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQR
RAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
SSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSL
TA
Target Type
Clinical trial
Target Bioclass
Immunoglobulin
Subcellular location
Cell membrane
Function
Antigen-presenting major histocompatibility complex class I (MHCI) molecule. In complex with B2M/beta 2 microglobulin displays primarily viral and tumor-derived peptides on antigen-presenting cells for recognition by alpha-beta T cell receptor (TCR) on HLA-B-restricted CD8-positive T cells, guiding antigen-specific T cell immune response to eliminate infected or transformed cells. May also present self-peptides derived from the signal sequence of secreted or membrane proteins, although T cells specific for these peptides are usually inactivated to prevent autoreactivity. Both the peptide and the MHC molecule are recognized by TCR, the peptide is responsible for the fine specificity of antigen recognition and MHC residues account for the MHC restriction of T cells. Typically presents intracellular peptide antigens of 8 to 13 amino acids that arise from cytosolic proteolysis via constitutive proteasome and IFNG-induced immunoproteasome. Can bind different peptides containing allele-specific binding motifs, which are mainly defined by anchor residues at position 2 and 9.; Allele B*07:02: Displays peptides sharing a common signature motif, namely a Pro residue at position 2 and mainly a Leu anchor residue at the C-terminus. Presents a long peptide (APRGPHGGAASGL) derived from the cancer-testis antigen CTAG1A/NY-ESO-1, eliciting a polyclonal CD8-positive T cell response against tumor cells. Presents viral epitopes derived from HIV-1 gag-pol (TPQDLNTML) and Nef (RPQVPLRPM). Presents an immunodominant epitope derived from SARS-CoV-2 N/nucleoprotein (SPRWYFYYL). Displays self-peptides including a peptide derived from the signal sequence of HLA-DPB1 (APRTVALTA).; Allele B*08:01: Presents to CD8-positive T cells viral epitopes derived from EBV/HHV-4 EBNA3 (QAKWRLQTL), eliciting cytotoxic T cell response.; Allele B*13:02: Presents multiple HIV-1 epitopes derived from gag (RQANFLGKI, GQMREPRGSDI), nef (RQDILDLWI), gag-pol (RQYDQILIE, GQGQWTYQI) and rev (LQLPPLERL), all having in common a Gln residue at position 2 and mainly hydrophobic amino acids Leu, Ile or Val at the C-terminus. Associated with succesful control of HIV-1 infection.; Allele B*18:01: Preferentially presents octomeric and nonameric peptides sharing a common motif, namely a Glu at position 2 and Phe or Tyr anchor residues at the C-terminus. Presents an EBV/HHV-4 epitope derived from BZLF1 (SELEIKRY). May present to CD8-positive T cells an antigenic peptide derived from MAGEA3 (MEVDPIGHLY), triggering an anti-tumor immune response. May display a broad repertoire of self-peptides with a preference for peptides derived from RNA-binding proteins.; Allele B*27:05: Presents to CD8-positive T cells immunodominant viral epitopes derived from HCV POLG (ARMILMTHF), HIV-1 gag (KRWIILGLNK), IAV NP (SRYWAIRTR), SARS-CoV-2 N/nucleoprotein (QRNAPRITF), EBV/HHV-4 EBNA4 (HRCQAIRKK) and EBV/HHV-4 EBNA6 (RRIYDLIEL), conferring longterm protection against viral infection. Can present self-peptides derived from cytosolic and nuclear proteins. All peptides carry an Arg at position 2. The peptide-bound form interacts with NK cell inhibitory receptor KIR3DL1 and inhibits NK cell activation in a peptide-specific way, being particularly sensitive to the nature of the amino acid side chain at position 8 of the antigenic peptide. KIR3DL1 fails to recognize HLA-B*27:05 in complex with B2M and EBV/HHV-4 EBNA6 (RRIYDLIEL) peptide, which can lead to increased activation of NK cells during infection. May present an altered repertoire of peptides in the absence of TAP1-TAP2 and TAPBPL.; Allele B*40:01: Presents immunodominant viral epitopes derived from EBV/HHV-4 LMP2 (IEDPPFNSL) and SARS-CoV-2 N/nucleoprotein (MEVTPSGTWL), triggering memory CD8-positive T cell response. Displays self-peptides sharing a signature motif, namely a Glu at position 2 and a Leu anchor residue at the C-terminus.; Allele B*41:01: Displays self-peptides sharing a signature motif, namely a Glu at position 2 and Ala or Pro anchor residues at the C-terminus.; Allele B*44:02: Presents immunodominant viral epitopes derived from EBV/HHV-4 EBNA4 (VEITPYKPTW) and EBNA6 (AEGGVGWRHW, EENLLDFVRF), triggering memory CD8-positive T cell response. Displays self-peptides sharing a signature motif, namely a Glu at position 2 and Phe, Tyr or Trp anchor residues at the C-terminus.; Allele B*45:01: Displays self-peptides sharing a signature motif, namely a Glu at position 2 and Ala or Pro anchor residues at the C-terminus.; Allele B*46:01: Preferentially presents nonameric peptides sharing a signature motif, namely Ala and Leu at position 2 and Tyr, Phe, Leu, or Met anchor residues at the C-terminus. The peptide-bound form interacts with KIR2DL3 and inhibits NK cell cytotoxic response in a peptide-specific way.; Allele B*47:01: Displays self-peptides sharing a signature motif, namely an Asp at position 2 and Leu or Met anchor residues at the C-terminus.; Allele B*49:01: Displays self-peptides sharing a signature motif, namely a Glu at position 2 and Ile or Val anchor residues at the C-terminus.; Allele B*50:01: Displays self-peptides sharing a signature motif, namely a Glu at position 2 and Ala or Pro anchor residues at the C-terminus.; Allele B*51:01: Presents an octomeric HIV-1 epitope derived from gag-pol (TAFTIPSI) to the public TRAV17/TRBV7-3 TCR clonotype, strongly suppressing HIV-1 replication.; Allele B*54:01: Displays peptides sharing a common signature motif, namely a Pro residue at position 2 and Ala anchor residue at the C-terminus.; Allele B*55:01: Displays peptides sharing a common signature motif, namely a Pro residue at position 2 and Ala anchor residue at the C-terminus.; Allele B*56:01: Displays peptides sharing a common signature motif, namely a Pro residue at position 2 and Ala anchor residue at the C-terminus.; Allele B*57:01: The peptide-bound form recognizes KIR3DL1 and inhibits NK cell cytotoxic response. Presents HIV gag peptides (immunodominant KAFSPEVIPMF and subdominant KALGPAATL epitopes) predominantly to CD8-positive T cell clones expressing a TRAV41-containing TCR, triggering HLA-B-restricted T cell responses.; Allele B*67:01: Displays peptides sharing a common signature motif, namely a Pro residue at position 2 and Leu anchor residue at the C-terminus.
TTD ID
T47415
Uniprot ID
P01889
DrugMap ID
TTGS10J
Ensemble ID
ENST00000412585.7
HGNC ID
HGNC:4932

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 18 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info 
15.00  LDD0402  [1]
OPA-S-S-alkyne
 Probe Info 
K210(2.33); K267(2.91); K292(7.46)  LDD3494  [2]
Alkylaryl probe 2
 Probe Info 
3.00  LDD0392  [3]
DBIA
 Probe Info 
C349(2.50)  LDD3314  [4]
P12
 Probe Info 
12.57  LDD0202  [5]
JZ128-DTB
 Probe Info 
N.A.  LDD0462  [6]
BTD
 Probe Info 
C283(1.93)  LDD1700  [7]
YY4-yne
 Probe Info 
4.65  LDD0400  [8]
5E-2FA
 Probe Info 
N.A.  LDD2235  [9]
4-Iodoacetamidophenylacetylene
 Probe Info 
N.A.  LDD0038  [10]
IA-alkyne
 Probe Info 
N.A.  LDD0032  [11]
Lodoacetamide azide
 Probe Info 
N.A.  LDD0037  [10]
IPM
 Probe Info 
C283(0.00); C188(0.00); C349(0.00)  LDD2156  [12]
TFBX
 Probe Info 
N.A.  LDD0148  [13]
Phosphinate-6
 Probe Info 
N.A.  LDD0018  [14]
Acrolein
 Probe Info 
H221(0.00); H212(0.00)  LDD0217  [15]
AOyne
 Probe Info 
12.90  LDD0443  [16]
NAIA_5
 Probe Info 
N.A.  LDD2223  [17]
PAL-AfBPP Probe
Click To Hide/Show 11 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C063
 Probe Info 
10.85  LDD1760  [18]
C071
 Probe Info 
8.82  LDD1767  [18]
C170
 Probe Info 
14.03  LDD1850  [18]
C197
 Probe Info 
5.10  LDD1873  [18]
C208
 Probe Info 
7.78  LDD1883  [18]
C310
 Probe Info 
8.82  LDD1977  [18]
C359
 Probe Info 
5.98  LDD2020  [18]
C425
 Probe Info 
9.51  LDD2080  [18]
STS-1
 Probe Info 
N.A.  LDD0136  [19]
STS-2
 Probe Info 
N.A.  LDD0138  [19]
DA-2
 Probe Info 
N.A.  LDD0072  [20]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0214  AC1 HEK-293T C283(1.03); C188(0.91)  LDD1507  [21]
 LDCM0215  AC10 HEK-293T C283(1.12); C188(0.89)  LDD1508  [21]
 LDCM0226  AC11 HEK-293T C283(1.02); C188(0.91)  LDD1509  [21]
 LDCM0237  AC12 HEK-293T C283(0.95); C188(1.08)  LDD1510  [21]
 LDCM0259  AC14 HEK-293T C283(0.99); C188(0.91)  LDD1512  [21]
 LDCM0270  AC15 HEK-293T C283(0.94); C188(0.91)  LDD1513  [21]
 LDCM0276  AC17 HEK-293T C283(0.96); C188(0.92)  LDD1515  [21]
 LDCM0277  AC18 HEK-293T C283(1.01); C188(0.86)  LDD1516  [21]
 LDCM0278  AC19 HEK-293T C283(1.23); C188(1.05)  LDD1517  [21]
 LDCM0279  AC2 HEK-293T C283(1.02); C188(1.01)  LDD1518  [21]
 LDCM0280  AC20 HEK-293T C283(1.03); C188(0.95)  LDD1519  [21]
 LDCM0281  AC21 HEK-293T C283(0.87); C188(1.11)  LDD1520  [21]
 LDCM0282  AC22 HEK-293T C283(1.03); C188(0.90)  LDD1521  [21]
 LDCM0283  AC23 HEK-293T C283(1.01); C188(0.92)  LDD1522  [21]
 LDCM0284  AC24 HEK-293T C283(0.99); C188(1.03)  LDD1523  [21]
 LDCM0285  AC25 HEK-293T C283(1.01); C188(0.96)  LDD1524  [21]
 LDCM0286  AC26 HEK-293T C283(1.05); C188(0.95)  LDD1525  [21]
 LDCM0287  AC27 HEK-293T C283(0.87); C188(0.94)  LDD1526  [21]
 LDCM0288  AC28 HEK-293T C283(1.01); C188(0.91)  LDD1527  [21]
 LDCM0289  AC29 HEK-293T C283(0.91); C188(1.06)  LDD1528  [21]
 LDCM0290  AC3 HEK-293T C283(1.03); C188(0.91)  LDD1529  [21]
 LDCM0291  AC30 HEK-293T C283(1.06); C188(0.98)  LDD1530  [21]
 LDCM0292  AC31 HEK-293T C283(0.89); C188(0.88)  LDD1531  [21]
 LDCM0293  AC32 HEK-293T C283(1.08); C188(1.01)  LDD1532  [21]
 LDCM0294  AC33 HEK-293T C283(0.92); C188(1.00)  LDD1533  [21]
 LDCM0295  AC34 HEK-293T C283(1.02); C188(0.94)  LDD1534  [21]
 LDCM0296  AC35 HEK-293T C283(1.00); C188(0.91)  LDD1535  [21]
 LDCM0297  AC36 HEK-293T C283(0.99); C188(1.09)  LDD1536  [21]
 LDCM0298  AC37 HEK-293T C283(0.91); C188(1.06)  LDD1537  [21]
 LDCM0299  AC38 HEK-293T C283(0.96); C188(0.93)  LDD1538  [21]
 LDCM0300  AC39 HEK-293T C283(0.99); C188(0.93)  LDD1539  [21]
 LDCM0301  AC4 HEK-293T C283(1.01); C188(1.09)  LDD1540  [21]
 LDCM0302  AC40 HEK-293T C283(1.02); C188(1.00)  LDD1541  [21]
 LDCM0303  AC41 HEK-293T C283(1.03); C188(0.94)  LDD1542  [21]
 LDCM0304  AC42 HEK-293T C283(0.97); C188(0.94)  LDD1543  [21]
 LDCM0305  AC43 HEK-293T C283(1.03); C188(1.02)  LDD1544  [21]
 LDCM0306  AC44 HEK-293T C283(0.92); C188(1.05)  LDD1545  [21]
 LDCM0307  AC45 HEK-293T C283(1.06); C188(0.93)  LDD1546  [21]
 LDCM0308  AC46 HEK-293T C283(0.98); C188(0.90)  LDD1547  [21]
 LDCM0309  AC47 HEK-293T C283(1.01); C188(0.98)  LDD1548  [21]
 LDCM0310  AC48 HEK-293T C283(0.92); C188(0.98)  LDD1549  [21]
 LDCM0311  AC49 HEK-293T C283(0.94); C188(0.95)  LDD1550  [21]
 LDCM0312  AC5 HEK-293T C283(0.88); C188(1.03)  LDD1551  [21]
 LDCM0313  AC50 HEK-293T C283(0.95); C188(1.06)  LDD1552  [21]
 LDCM0314  AC51 HEK-293T C283(1.00); C188(0.92)  LDD1553  [21]
 LDCM0315  AC52 HEK-293T C283(0.96); C188(1.05)  LDD1554  [21]
 LDCM0316  AC53 HEK-293T C283(0.93); C188(1.02)  LDD1555  [21]
 LDCM0317  AC54 HEK-293T C283(1.00); C188(0.92)  LDD1556  [21]
 LDCM0318  AC55 HEK-293T C283(0.97); C188(0.93)  LDD1557  [21]
 LDCM0319  AC56 HEK-293T C283(0.98); C188(1.08)  LDD1558  [21]
 LDCM0320  AC57 HEK-293T C283(0.93); C188(0.94)  LDD1559  [21]
 LDCM0321  AC58 HEK-293T C283(0.96); C188(0.98)  LDD1560  [21]
 LDCM0322  AC59 HEK-293T C283(1.00); C188(0.90)  LDD1561  [21]
 LDCM0323  AC6 HEK-293T C283(1.03); C188(0.93)  LDD1562  [21]
 LDCM0324  AC60 HEK-293T C283(0.98); C188(1.03)  LDD1563  [21]
 LDCM0325  AC61 HEK-293T C283(0.92); C188(1.05)  LDD1564  [21]
 LDCM0326  AC62 HEK-293T C283(1.00); C188(0.98)  LDD1565  [21]
 LDCM0327  AC63 HEK-293T C283(0.91); C188(0.92)  LDD1566  [21]
 LDCM0328  AC64 HEK-293T C283(1.01); C188(1.02)  LDD1567  [21]
 LDCM0334  AC7 HEK-293T C283(0.88); C188(0.89)  LDD1568  [21]
 LDCM0345  AC8 HEK-293T C283(0.96); C188(1.04)  LDD1569  [21]
 LDCM0545  Acetamide MDA-MB-231 C283(0.81)  LDD2170  [7]
 LDCM0248  AKOS034007472 HEK-293T C283(0.98); C188(0.99)  LDD1511  [21]
 LDCM0356  AKOS034007680 HEK-293T C283(1.01); C188(0.95)  LDD1570  [21]
 LDCM0275  AKOS034007705 HEK-293T C283(0.94); C188(1.01)  LDD1514  [21]
 LDCM0088  C45 HEK-293T 12.57  LDD0202  [5]
 LDCM0108  Chloroacetamide HeLa H212(0.00); H221(0.00); H215(0.00)  LDD0222  [15]
 LDCM0367  CL1 HEK-293T C283(1.09); C188(1.04)  LDD1571  [21]
 LDCM0368  CL10 HEK-293T C283(1.25); C188(0.98)  LDD1572  [21]
 LDCM0369  CL100 HEK-293T C283(1.13); C188(0.93)  LDD1573  [21]
 LDCM0370  CL101 HEK-293T C283(1.12); C188(0.95)  LDD1574  [21]
 LDCM0371  CL102 HEK-293T C283(1.04); C188(1.04)  LDD1575  [21]
 LDCM0372  CL103 HEK-293T C283(1.01); C188(1.03)  LDD1576  [21]
 LDCM0373  CL104 HEK-293T C283(1.11); C188(1.00)  LDD1577  [21]
 LDCM0374  CL105 HEK-293T C283(0.96); C188(0.91)  LDD1578  [21]
 LDCM0375  CL106 HEK-293T C283(1.12); C188(1.03)  LDD1579  [21]
 LDCM0376  CL107 HEK-293T C283(0.97); C188(1.07)  LDD1580  [21]
 LDCM0377  CL108 HEK-293T C283(1.06); C188(0.99)  LDD1581  [21]
 LDCM0378  CL109 HEK-293T C283(1.00); C188(0.98)  LDD1582  [21]
 LDCM0379  CL11 HEK-293T C283(0.92); C188(1.15)  LDD1583  [21]
 LDCM0380  CL110 HEK-293T C283(1.07); C188(1.03)  LDD1584  [21]
 LDCM0381  CL111 HEK-293T C283(1.11); C188(1.03)  LDD1585  [21]
 LDCM0382  CL112 HEK-293T C283(1.04); C188(0.99)  LDD1586  [21]
 LDCM0383  CL113 HEK-293T C283(1.03); C188(1.00)  LDD1587  [21]
 LDCM0384  CL114 HEK-293T C283(1.16); C188(1.00)  LDD1588  [21]
 LDCM0385  CL115 HEK-293T C283(0.98); C188(1.03)  LDD1589  [21]
 LDCM0386  CL116 HEK-293T C283(1.09); C188(0.94)  LDD1590  [21]
 LDCM0387  CL117 HEK-293T C283(0.97); C188(1.02)  LDD1591  [21]
 LDCM0388  CL118 HEK-293T C283(1.05); C188(0.93)  LDD1592  [21]
 LDCM0389  CL119 HEK-293T C283(1.08); C188(1.00)  LDD1593  [21]
 LDCM0390  CL12 HEK-293T C283(1.02); C188(1.11)  LDD1594  [21]
 LDCM0391  CL120 HEK-293T C283(1.05); C188(1.03)  LDD1595  [21]
 LDCM0392  CL121 HEK-293T C283(0.92); C188(0.91)  LDD1596  [21]
 LDCM0393  CL122 HEK-293T C283(1.03); C188(1.05)  LDD1597  [21]
 LDCM0394  CL123 HEK-293T C283(1.04); C188(1.09)  LDD1598  [21]
 LDCM0395  CL124 HEK-293T C283(1.01); C188(1.01)  LDD1599  [21]
 LDCM0396  CL125 HEK-293T C283(1.13); C188(1.06)  LDD1600  [21]
 LDCM0397  CL126 HEK-293T C283(1.04); C188(1.00)  LDD1601  [21]
 LDCM0398  CL127 HEK-293T C283(0.94); C188(0.97)  LDD1602  [21]
 LDCM0399  CL128 HEK-293T C283(1.05); C188(1.00)  LDD1603  [21]
 LDCM0400  CL13 HEK-293T C283(0.96); C188(1.02)  LDD1604  [21]
 LDCM0401  CL14 HEK-293T C283(1.01); C188(1.07)  LDD1605  [21]
 LDCM0402  CL15 HEK-293T C283(1.27); C188(1.06)  LDD1606  [21]
 LDCM0403  CL16 HEK-293T C283(1.11); C188(0.95)  LDD1607  [21]
 LDCM0404  CL17 HEK-293T C283(1.11); C188(1.01)  LDD1608  [21]
 LDCM0405  CL18 HEK-293T C283(1.07); C188(0.81)  LDD1609  [21]
 LDCM0406  CL19 HEK-293T C283(0.97); C188(1.03)  LDD1610  [21]
 LDCM0407  CL2 HEK-293T C283(0.95); C188(1.10)  LDD1611  [21]
 LDCM0408  CL20 HEK-293T C283(1.08); C188(1.02)  LDD1612  [21]
 LDCM0409  CL21 HEK-293T C283(1.01); C188(1.14)  LDD1613  [21]
 LDCM0410  CL22 HEK-293T C283(1.03); C188(1.05)  LDD1614  [21]
 LDCM0411  CL23 HEK-293T C283(0.98); C188(1.03)  LDD1615  [21]
 LDCM0412  CL24 HEK-293T C283(1.09); C188(1.11)  LDD1616  [21]
 LDCM0413  CL25 HEK-293T C283(1.02); C188(0.98)  LDD1617  [21]
 LDCM0414  CL26 HEK-293T C283(0.98); C188(1.01)  LDD1618  [21]
 LDCM0415  CL27 HEK-293T C283(1.03); C188(1.04)  LDD1619  [21]
 LDCM0416  CL28 HEK-293T C283(1.03); C188(0.98)  LDD1620  [21]
 LDCM0417  CL29 HEK-293T C283(1.02); C188(0.95)  LDD1621  [21]
 LDCM0418  CL3 HEK-293T C283(1.01); C188(0.97)  LDD1622  [21]
 LDCM0419  CL30 HEK-293T C283(0.99); C188(0.99)  LDD1623  [21]
 LDCM0420  CL31 HEK-293T C283(1.15); C188(0.92)  LDD1624  [21]
 LDCM0421  CL32 HEK-293T C283(1.05); C188(1.03)  LDD1625  [21]
 LDCM0422  CL33 HEK-293T C283(1.20); C188(1.28)  LDD1626  [21]
 LDCM0423  CL34 HEK-293T C283(0.99); C188(1.03)  LDD1627  [21]
 LDCM0424  CL35 HEK-293T C283(1.08); C188(1.06)  LDD1628  [21]
 LDCM0425  CL36 HEK-293T C283(0.92); C188(1.07)  LDD1629  [21]
 LDCM0426  CL37 HEK-293T C283(0.92); C188(1.03)  LDD1630  [21]
 LDCM0428  CL39 HEK-293T C283(1.02); C188(1.00)  LDD1632  [21]
 LDCM0429  CL4 HEK-293T C283(1.13); C188(1.04)  LDD1633  [21]
 LDCM0430  CL40 HEK-293T C283(0.98); C188(1.02)  LDD1634  [21]
 LDCM0431  CL41 HEK-293T C283(1.07); C188(0.92)  LDD1635  [21]
 LDCM0432  CL42 HEK-293T C283(0.98); C188(1.01)  LDD1636  [21]
 LDCM0433  CL43 HEK-293T C283(1.00); C188(0.98)  LDD1637  [21]
 LDCM0434  CL44 HEK-293T C283(1.07); C188(1.13)  LDD1638  [21]
 LDCM0435  CL45 HEK-293T C283(1.07); C188(1.05)  LDD1639  [21]
 LDCM0436  CL46 HEK-293T C283(1.03); C188(1.02)  LDD1640  [21]
 LDCM0437  CL47 HEK-293T C283(0.86); C188(1.00)  LDD1641  [21]
 LDCM0438  CL48 HEK-293T C283(1.06); C188(1.14)  LDD1642  [21]
 LDCM0439  CL49 HEK-293T C283(0.95); C188(0.96)  LDD1643  [21]
 LDCM0440  CL5 HEK-293T C283(0.98); C188(1.02)  LDD1644  [21]
 LDCM0441  CL50 HEK-293T C283(1.01); C188(1.04)  LDD1645  [21]
 LDCM0443  CL52 HEK-293T C283(1.07); C188(1.02)  LDD1646  [21]
 LDCM0444  CL53 HEK-293T C283(0.98); C188(1.02)  LDD1647  [21]
 LDCM0445  CL54 HEK-293T C283(1.05); C188(1.31)  LDD1648  [21]
 LDCM0446  CL55 HEK-293T C283(0.95); C188(0.95)  LDD1649  [21]
 LDCM0447  CL56 HEK-293T C283(0.94); C188(1.04)  LDD1650  [21]
 LDCM0448  CL57 HEK-293T C283(1.02); C188(1.04)  LDD1651  [21]
 LDCM0449  CL58 HEK-293T C283(1.04); C188(1.06)  LDD1652  [21]
 LDCM0450  CL59 HEK-293T C283(0.95); C188(1.08)  LDD1653  [21]
 LDCM0451  CL6 HEK-293T C283(1.06); C188(1.11)  LDD1654  [21]
 LDCM0452  CL60 HEK-293T C283(1.02); C188(0.99)  LDD1655  [21]
 LDCM0453  CL61 HEK-293T C283(0.83); C188(0.99)  LDD1656  [21]
 LDCM0454  CL62 HEK-293T C283(0.99); C188(0.96)  LDD1657  [21]
 LDCM0455  CL63 HEK-293T C283(0.88); C188(0.97)  LDD1658  [21]
 LDCM0456  CL64 HEK-293T C283(1.05); C188(1.04)  LDD1659  [21]
 LDCM0457  CL65 HEK-293T C283(0.92); C188(0.97)  LDD1660  [21]
 LDCM0458  CL66 HEK-293T C283(0.98); C188(1.07)  LDD1661  [21]
 LDCM0459  CL67 HEK-293T C283(0.93); C188(0.95)  LDD1662  [21]
 LDCM0460  CL68 HEK-293T C283(0.95); C188(1.08)  LDD1663  [21]
 LDCM0461  CL69 HEK-293T C283(0.93); C188(1.08)  LDD1664  [21]
 LDCM0462  CL7 HEK-293T C283(1.05); C188(0.95)  LDD1665  [21]
 LDCM0463  CL70 HEK-293T C283(0.97); C188(0.95)  LDD1666  [21]
 LDCM0464  CL71 HEK-293T C283(0.86); C188(0.99)  LDD1667  [21]
 LDCM0465  CL72 HEK-293T C283(0.96); C188(1.04)  LDD1668  [21]
 LDCM0466  CL73 HEK-293T C283(1.16); C188(0.99)  LDD1669  [21]
 LDCM0467  CL74 HEK-293T C283(0.98); C188(0.96)  LDD1670  [21]
 LDCM0469  CL76 HEK-293T C283(1.11); C188(0.97)  LDD1672  [21]
 LDCM0470  CL77 HEK-293T C283(1.03); C188(0.87)  LDD1673  [21]
 LDCM0471  CL78 HEK-293T C283(1.01); C188(0.82)  LDD1674  [21]
 LDCM0472  CL79 HEK-293T C283(0.98); C188(0.95)  LDD1675  [21]
 LDCM0473  CL8 HEK-293T C283(1.43); C188(1.28)  LDD1676  [21]
 LDCM0474  CL80 HEK-293T C283(0.94); C188(0.97)  LDD1677  [21]
 LDCM0475  CL81 HEK-293T C283(0.97); C188(1.06)  LDD1678  [21]
 LDCM0476  CL82 HEK-293T C283(0.98); C188(0.98)  LDD1679  [21]
 LDCM0477  CL83 HEK-293T C283(1.11); C188(1.07)  LDD1680  [21]
 LDCM0478  CL84 HEK-293T C283(1.02); C188(1.01)  LDD1681  [21]
 LDCM0479  CL85 HEK-293T C283(0.90); C188(0.99)  LDD1682  [21]
 LDCM0480  CL86 HEK-293T C283(0.89); C188(1.01)  LDD1683  [21]
 LDCM0481  CL87 HEK-293T C283(0.89); C188(0.93)  LDD1684  [21]
 LDCM0482  CL88 HEK-293T C283(1.06); C188(0.94)  LDD1685  [21]
 LDCM0483  CL89 HEK-293T C283(0.93); C188(0.93)  LDD1686  [21]
 LDCM0484  CL9 HEK-293T C283(1.02); C188(1.22)  LDD1687  [21]
 LDCM0485  CL90 HEK-293T C283(1.25); C188(1.34)  LDD1688  [21]
 LDCM0486  CL91 HEK-293T C283(0.93); C188(0.94)  LDD1689  [21]
 LDCM0487  CL92 HEK-293T C283(0.98); C188(1.02)  LDD1690  [21]
 LDCM0488  CL93 HEK-293T C283(0.91); C188(1.23)  LDD1691  [21]
 LDCM0489  CL94 HEK-293T C283(0.97); C188(0.93)  LDD1692  [21]
 LDCM0490  CL95 HEK-293T C283(1.21); C188(1.03)  LDD1693  [21]
 LDCM0491  CL96 HEK-293T C283(0.96); C188(1.03)  LDD1694  [21]
 LDCM0492  CL97 HEK-293T C283(0.89); C188(0.98)  LDD1695  [21]
 LDCM0493  CL98 HEK-293T C283(1.10); C188(1.06)  LDD1696  [21]
 LDCM0494  CL99 HEK-293T C283(1.19); C188(0.93)  LDD1697  [21]
 LDCM0495  E2913 HEK-293T C283(0.91); C188(0.97)  LDD1698  [21]
 LDCM0468  Fragment33 HEK-293T C283(0.97); C188(0.96)  LDD1671  [21]
 LDCM0427  Fragment51 HEK-293T C283(1.12); C188(1.00)  LDD1631  [21]
 LDCM0107  IAA HeLa H212(0.00); H221(0.00); H216(0.00)  LDD0221  [15]
 LDCM0179  JZ128 PC-3 N.A.  LDD0462  [6]
 LDCM0022  KB02 HEK-293T C283(0.98); C188(0.90)  LDD1492  [21]
 LDCM0023  KB03 HEK-293T C283(1.01); C188(1.13)  LDD1497  [21]
 LDCM0024  KB05 IGR37 C349(2.50)  LDD3314  [4]
 LDCM0109  NEM HeLa H212(0.00); H221(0.00)  LDD0223  [15]
 LDCM0211  Nucleophilic fragment 3b MDA-MB-231 C283(1.93)  LDD1700  [7]
 LDCM0627  NUDT7-COV-1 HEK-293T C188(0.85)  LDD2206  [22]
 LDCM0628  OTUB2-COV-1 HEK-293T C188(1.08)  LDD2207  [22]
 LDCM0099  Phenelzine MDA-MB-231 3.00  LDD0392  [3]
 LDCM0154  YY4 T cell 4.65  LDD0400  [8]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Immunoglobulin
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Killer cell immunoglobulin-like receptor 2DL1 (KIR2DL1) Immunoglobulin superfamily P43626
Killer cell immunoglobulin-like receptor 2DL3 (KIR2DL3) Immunoglobulin superfamily P43628
Killer cell immunoglobulin-like receptor 2DS4 (KIR2DS4) Immunoglobulin superfamily P43632
Killer cell immunoglobulin-like receptor 3DS1 (KIR3DS1) Immunoglobulin superfamily Q14943
Leukocyte immunoglobulin-like receptor subfamily B member 2 (LILRB2) . Q8N423
Tapasin-related protein (TAPBPL) . Q9BX59

The Drug(s) Related To This Target

Approved
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Abacavir Small molecular drug DB01048
Coccidioides Immitis Spherule . DB11294
Investigative
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
N-formylmethionine Small molecular drug DB04464

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
3 Hydrazines as versatile chemical biology probes and drug-discovery tools for cofactor-dependent enzymes. bioRxiv, 2020-06.
4 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
5 Discovery of Potent and Selective Inhibitors against Protein-Derived Electrophilic Cofactors. J Am Chem Soc. 2022 Mar 30;144(12):5377-5388. doi: 10.1021/jacs.1c12748. Epub 2022 Mar 2.
6 A Chemoproteomic Strategy for Direct and Proteome-Wide Covalent Inhibitor Target-Site Identification. J Am Chem Soc. 2019 Jan 9;141(1):191-203. doi: 10.1021/jacs.8b07911. Epub 2018 Dec 20.
7 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
8 A Chemical Proteomic Probe for the Mitochondrial Pyruvate Carrier Complex. Angew Chem Int Ed Engl. 2020 Mar 2;59(10):3896-3899. doi: 10.1002/anie.201914391. Epub 2020 Feb 11.
9 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
10 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
11 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
12 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
13 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
14 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
15 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
16 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
17 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
18 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
19 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.
20 Cell-based proteome profiling of potential dasatinib targets by use of affinity-based probes. J Am Chem Soc. 2012 Feb 15;134(6):3001-14. doi: 10.1021/ja208518u. Epub 2012 Feb 1.
21 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
22 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.