Details of the Target
General Information of Target
| Target ID | LDTP10116 | |||||
|---|---|---|---|---|---|---|
| Target Name | Lipid droplet assembly factor 1 (LDAF1) | |||||
| Gene Name | LDAF1 | |||||
| Gene ID | 57146 | |||||
| Synonyms |
TMEM159; Lipid droplet assembly factor 1; Promethin; Transmembrane protein 159 |
|||||
| 3D Structure | ||||||
| Sequence |
MQPPRERLVVTGRAGWMGMGRGAGRSALGFWPTLAFLLCSFPAATSPCKILKCNSEFWSA
TSGSHAPASDDTPEFCAALRSYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDGP TSQPRLRTLPPAGDSQERSDSPEICHYEKSFHKHSATPNYTHCGLFGDPHLRTFTDRFQT CKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELP AAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEV VNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETA VAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDL PGRAAAGLPLAPRPLLGALVPLLALLPVFC |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
LDAF1 family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Plays an important role in the formation of lipid droplets (LD) which are storage organelles at the center of lipid and energy homeostasis. In association with BSCL2/seipin, defines the sites of LD formation in the endoplasmic reticulum.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K19(2.38) | LDD0277 | [1] | |
|
NAIA_5 Probe Info |
![]() |
C144(1.19) | LDD2228 | [2] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C055 Probe Info |
![]() |
14.12 | LDD1752 | [3] | |
|
C056 Probe Info |
![]() |
20.53 | LDD1753 | [3] | |
|
C112 Probe Info |
![]() |
24.42 | LDD1799 | [3] | |
|
C169 Probe Info |
![]() |
28.05 | LDD1849 | [3] | |
|
C225 Probe Info |
![]() |
5.90 | LDD1898 | [3] | |
|
C226 Probe Info |
![]() |
6.32 | LDD1899 | [3] | |
|
C228 Probe Info |
![]() |
28.64 | LDD1901 | [3] | |
|
C264 Probe Info |
![]() |
28.25 | LDD1935 | [3] | |
|
C285 Probe Info |
![]() |
33.36 | LDD1955 | [3] | |
|
C287 Probe Info |
![]() |
22.94 | LDD1957 | [3] | |
|
C288 Probe Info |
![]() |
8.51 | LDD1958 | [3] | |
|
C289 Probe Info |
![]() |
69.55 | LDD1959 | [3] | |
|
C290 Probe Info |
![]() |
4.99 | LDD1960 | [3] | |
|
C299 Probe Info |
![]() |
8.94 | LDD1968 | [3] | |
|
C373 Probe Info |
![]() |
8.00 | LDD2033 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Glutamate decarboxylase 2 (GAD2) | Group II decarboxylase family | Q05329 | |||
| Atypical kinase COQ8A, mitochondrial (COQ8A) | ADCK protein kinase family | Q8NI60 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Calcium channel flower homolog (CACFD1) | Calcium channel flower family | Q9UGQ2 | |||
| Heme transporter HRG1 (SLC48A1) | HRG family | Q6P1K1 | |||
Other
References

















