Details of the Target
General Information of Target
Target ID | LDTP09644 | |||||
---|---|---|---|---|---|---|
Target Name | m-AAA protease-interacting protein 1, mitochondrial (MAIP1) | |||||
Gene Name | MAIP1 | |||||
Gene ID | 79568 | |||||
Synonyms |
C2orf47; m-AAA protease-interacting protein 1, mitochondrial; Matrix AAA peptidase-interacting protein 1 |
|||||
3D Structure | ||||||
Sequence |
MALAARLLPQFLHSRSLPCGAVRLRTPAVAEVRLPSATLCYFCRCRLGLGAALFPRSARA
LAASALPAQGSRWPVLSSPGLPAAFASFPACPQRSYSTEEKPQQHQKTKMIVLGFSNPIN WVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVLHALK EKVTSLPDNHKNALAANIDEIVFTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETL RGASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE |
|||||
Target Bioclass |
Other
|
|||||
Subcellular location |
Mitochondrion matrix
|
|||||
Function |
Promotes sorting of SMDT1/EMRE in mitochondria by ensuring its maturation. Interacts with the transit peptide region of SMDT1/EMRE precursor protein in the mitochondrial matrix, leading to protect it against protein degradation by YME1L1, thereby ensuring SMDT1/EMRE maturation by the mitochondrial processing peptidase (PMPCA and PMPCB).
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
m-APA Probe Info |
![]() |
14.68 | LDD0402 | [1] | |
N1 Probe Info |
![]() |
100.00 | LDD0242 | [2] | |
STPyne Probe Info |
![]() |
K288(10.00) | LDD0277 | [3] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0165 | [4] | |
ENE Probe Info |
![]() |
N.A. | LDD0006 | [5] | |
IPM Probe Info |
![]() |
N.A. | LDD2156 | [6] | |
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [7] | |
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [8] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [9] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C040 Probe Info |
![]() |
9.99 | LDD1740 | [10] | |
C091 Probe Info |
![]() |
12.38 | LDD1782 | [10] | |
C092 Probe Info |
![]() |
22.94 | LDD1783 | [10] | |
C094 Probe Info |
![]() |
32.22 | LDD1785 | [10] | |
C218 Probe Info |
![]() |
12.38 | LDD1892 | [10] | |
C220 Probe Info |
![]() |
12.04 | LDD1894 | [10] | |
C228 Probe Info |
![]() |
16.22 | LDD1901 | [10] | |
C231 Probe Info |
![]() |
12.55 | LDD1904 | [10] | |
C285 Probe Info |
![]() |
23.75 | LDD1955 | [10] | |
C289 Probe Info |
![]() |
29.65 | LDD1959 | [10] | |
C376 Probe Info |
![]() |
6.63 | LDD2036 | [10] | |
C380 Probe Info |
![]() |
5.21 | LDD2039 | [10] | |
C382 Probe Info |
![]() |
9.51 | LDD2041 | [10] | |
C388 Probe Info |
![]() |
41.93 | LDD2047 | [10] | |
C429 Probe Info |
![]() |
12.91 | LDD2084 | [10] | |
C431 Probe Info |
![]() |
19.03 | LDD2086 | [10] | |
FFF probe11 Probe Info |
![]() |
17.48 | LDD0471 | [11] | |
FFF probe2 Probe Info |
![]() |
20.00 | LDD0463 | [11] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0156 | Aniline | NCI-H1299 | 11.70 | LDD0403 | [1] |
LDCM0625 | F8 | Ramos | C162(0.59) | LDD2187 | [12] |
LDCM0573 | Fragment11 | Ramos | C162(3.31) | LDD2190 | [12] |
LDCM0576 | Fragment14 | Ramos | C162(1.31) | LDD2193 | [12] |
LDCM0586 | Fragment28 | Ramos | C162(0.72) | LDD2198 | [12] |
LDCM0566 | Fragment4 | Ramos | C162(0.48) | LDD2184 | [12] |
LDCM0569 | Fragment7 | Ramos | C162(2.49) | LDD2186 | [12] |
LDCM0022 | KB02 | Ramos | C162(1.36) | LDD2182 | [12] |
LDCM0023 | KB03 | Ramos | C162(0.61) | LDD2183 | [12] |
LDCM0024 | KB05 | Ramos | C162(1.22) | LDD2185 | [12] |
LDCM0627 | NUDT7-COV-1 | HEK-293T | C162(0.34) | LDD2206 | [13] |
LDCM0628 | OTUB2-COV-1 | HEK-293T | C162(0.69) | LDD2207 | [13] |
The Interaction Atlas With This Target
References