Details of the Target

General Information of Target

Target ID LDTP04319
Target Name Glycogen synthase kinase-3 beta (GSK3B)
Gene Name GSK3B
Gene ID 2932
Synonyms
Glycogen synthase kinase-3 beta; GSK-3 beta; EC 2.7.11.26; Serine/threonine-protein kinase GSK3B; EC 2.7.11.1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Target Type
Clinical trial
Target Bioclass
Enzyme
Family
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, GSK-3 subfamily
Subcellular location
Cytoplasm
Function
Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), EIF2B, CTNNB1/beta-catenin, APC, AXIN1, DPYSL2/CRMP2, JUN, NFATC1/NFATC, MAPT/TAU and MACF1. Requires primed phosphorylation of the majority of its substrates. In skeletal muscle, contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. May also mediate the development of insulin resistance by regulating activation of transcription factors. Regulates protein synthesis by controlling the activity of initiation factor 2B (EIF2BE/EIF2B5) in the same manner as glycogen synthase. In Wnt signaling, GSK3B forms a multimeric complex with APC, AXIN1 and CTNNB1/beta-catenin and phosphorylates the N-terminus of CTNNB1 leading to its degradation mediated by ubiquitin/proteasomes. Phosphorylates JUN at sites proximal to its DNA-binding domain, thereby reducing its affinity for DNA. Phosphorylates NFATC1/NFATC on conserved serine residues promoting NFATC1/NFATC nuclear export, shutting off NFATC1/NFATC gene regulation, and thereby opposing the action of calcineurin. Phosphorylates MAPT/TAU on 'Thr-548', decreasing significantly MAPT/TAU ability to bind and stabilize microtubules. MAPT/TAU is the principal component of neurofibrillary tangles in Alzheimer disease. Plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. Phosphorylates MACF1, inhibiting its binding to microtubules which is critical for its role in bulge stem cell migration and skin wound repair. Probably regulates NF-kappa-B (NFKB1) at the transcriptional level and is required for the NF-kappa-B-mediated anti-apoptotic response to TNF-alpha (TNF/TNFA). Negatively regulates replication in pancreatic beta-cells, resulting in apoptosis, loss of beta-cells and diabetes. Through phosphorylation of the anti-apoptotic protein MCL1, may control cell apoptosis in response to growth factors deprivation. Phosphorylates MUC1 in breast cancer cells, decreasing the interaction of MUC1 with CTNNB1/beta-catenin. Is necessary for the establishment of neuronal polarity and axon outgrowth. Phosphorylates MARK2, leading to inhibition of its activity. Phosphorylates SIK1 at 'Thr-182', leading to sustainment of its activity. Phosphorylates ZC3HAV1 which enhances its antiviral activity. Phosphorylates SNAI1, leading to its BTRC-triggered ubiquitination and proteasomal degradation. Phosphorylates SFPQ at 'Thr-687' upon T-cell activation. Phosphorylates NR1D1 st 'Ser-55' and 'Ser-59' and stabilizes it by protecting it from proteasomal degradation. Regulates the circadian clock via phosphorylation of the major clock components including BMAL1, CLOCK and PER2. Phosphorylates FBXL2 at 'Thr-404' and primes it for ubiquitination by the SCF(FBXO3) complex and proteasomal degradation. Phosphorylates CLOCK AT 'Ser-427' and targets it for proteasomal degradation. Phosphorylates BMAL1 at 'Ser-17' and 'Ser-21' and primes it for ubiquitination and proteasomal degradation. Phosphorylates OGT at 'Ser-3' or 'Ser-4' which positively regulates its activity. Phosphorylates MYCN in neuroblastoma cells which may promote its degradation. Regulates the circadian rhythmicity of hippocampal long-term potentiation and BMAL1 and PER2 expression. Acts as a regulator of autophagy by mediating phosphorylation of KAT5/TIP60 under starvation conditions, activating KAT5/TIP60 acetyltransferase activity and promoting acetylation of key autophagy regulators, such as ULK1 and RUBCNL/Pacer. Negatively regulates extrinsic apoptotic signaling pathway via death domain receptors. Promotes the formation of an anti-apoptotic complex, made of DDX3X, BRIC2 and GSK3B, at death receptors, including TNFRSF10B. The anti-apoptotic function is most effective with weak apoptotic signals and can be overcome by stronger stimulation. Phosphorylates E2F1, promoting the interaction between E2F1 and USP11, stabilizing E2F1 and promoting its activity. Phosphorylates mTORC2 complex component RICTOR at 'Thr-1695' which facilitates FBXW7-mediated ubiquitination and subsequent degradation of RICTOR. Phosphorylates FXR1, promoting FXR1 ubiquitination by the SCF(FBXO4) complex and FXR1 degradation by the proteasome. Phosphorylates interleukin-22 receptor subunit IL22RA1, preventing its proteasomal degradation.
TTD ID
T70977
Uniprot ID
P49841
DrugMap ID
TTRSMW9
Ensemble ID
ENST00000264235.13
HGNC ID
HGNC:4617
ChEMBL ID
CHEMBL262

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
LS180 SNV: p.D33G DBIA    Probe Info 
MDST8 SNV: p.R306Q DBIA    Probe Info 
SNU1 SNV: p.R306Ter DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 31 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
BTD
 Probe Info  		C76(1.24)  LDD1699  [2]
Probe 1
 Probe Info  		Y56(14.61)  LDD3495  [3]
DBIA
 Probe Info  		C170(2.10); C330(2.13)  LDD3310  [4]
JZ128-DTB
 Probe Info  		N.A.  LDD0462  [5]
THZ1-DTB
 Probe Info  		C14(1.48)  LDD0460  [5]
AHL-Pu-1
 Probe Info  		C14(2.39)  LDD0169  [6]
HHS-482
 Probe Info  		Y288(1.96)  LDD0286  [7]
HHS-475
 Probe Info  		Y288(1.01)  LDD0264  [8]
HHS-465
 Probe Info  		Y288(4.87)  LDD2237  [9]
ATP probe
 Probe Info  		N.A.  LDD0199  [10]
4-Iodoacetamidophenylacetylene
 Probe Info  		C107(0.00); C76(0.00); C335(0.00); C178(0.00)  LDD0038  [11]
IA-alkyne
 Probe Info  		C199(0.00); C14(0.00)  LDD0032  [12]
IPIAA_L
 Probe Info  		N.A.  LDD0031  [13]
Lodoacetamide azide
 Probe Info  		C199(0.00); C76(0.00); C107(0.00); C335(0.00)  LDD0037  [11]
ATP probe
 Probe Info  		N.A.  LDD0035  [14]
JW-RF-010
 Probe Info  		C317(0.00); C218(0.00)  LDD0026  [15]
NAIA_4
 Probe Info  		C14(0.00); C76(0.00)  LDD2226  [16]
TFBX
 Probe Info  		C317(0.00); C14(0.00); C199(0.00)  LDD0027  [15]
WYneN
 Probe Info  		N.A.  LDD0021  [17]
WYneO
 Probe Info  		N.A.  LDD0022  [17]
Compound 10
 Probe Info  		C14(0.00); C218(0.00)  LDD2216  [18]
Compound 11
 Probe Info  		N.A.  LDD2213  [18]
IPM
 Probe Info  		C199(0.00); C14(0.00)  LDD0005  [17]
PF-06672131
 Probe Info  		N.A.  LDD0017  [19]
VSF
 Probe Info  		C14(0.00); C199(0.00); C76(0.00)  LDD0007  [17]
Phosphinate-6
 Probe Info  		C14(0.00); C199(0.00)  LDD0018  [20]
Methacrolein
 Probe Info  		N.A.  LDD0218  [21]
W1
 Probe Info  		C317(0.00); C335(0.00)  LDD0236  [22]
AOyne
 Probe Info  		14.70  LDD0443  [23]
NAIA_5
 Probe Info  		C76(0.00); C335(0.00); C178(0.00); C317(0.00)  LDD2223  [16]
PAL-AfBPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C289
 Probe Info  		32.67  LDD1959  [24]
DFG-out-3
 Probe Info  		3.60  LDD0074  [25]
Staurosporine capture compound
 Probe Info  		N.A.  LDD0083  [26]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C107(1.28); C199(1.72)  LDD2117  [2]
 LDCM0558  2-Cyano-N-phenylacetamide MDA-MB-231 C107(1.69)  LDD2152  [2]
 LDCM0026  4SU-RNA+native RNA HEK-293T C14(2.39)  LDD0169  [6]
 LDCM0214  AC1 HEK-293T C317(1.01); C76(0.93); C14(0.97); C178(0.85)  LDD1507  [27]
 LDCM0215  AC10 HEK-293T C317(1.03); C76(1.05); C14(1.08); C335(1.09)  LDD1508  [27]
 LDCM0226  AC11 HEK-293T C317(1.08); C76(1.00); C14(0.95); C335(1.12)  LDD1509  [27]
 LDCM0237  AC12 HEK-293T C317(0.96); C76(0.98); C14(0.91); C335(0.98)  LDD1510  [27]
 LDCM0259  AC14 HEK-293T C317(1.03); C76(1.01); C14(0.94); C335(0.98)  LDD1512  [27]
 LDCM0270  AC15 HEK-293T C317(1.04); C76(1.08); C14(1.02); C335(0.99)  LDD1513  [27]
 LDCM0276  AC17 HEK-293T C317(1.00); C76(0.96); C14(0.97); C178(0.87)  LDD1515  [27]
 LDCM0277  AC18 HEK-293T C317(1.05); C76(1.05); C14(1.04); C335(1.01)  LDD1516  [27]
 LDCM0278  AC19 HEK-293T C317(1.14); C76(0.86); C14(1.03); C335(1.13)  LDD1517  [27]
 LDCM0279  AC2 HEK-293T C317(1.07); C76(1.10); C14(0.99); C335(1.03)  LDD1518  [27]
 LDCM0280  AC20 HEK-293T C317(0.99); C76(0.96); C14(0.94); C335(0.99)  LDD1519  [27]
 LDCM0281  AC21 HEK-293T C317(1.06); C76(0.96); C14(0.98); C335(1.01)  LDD1520  [27]
 LDCM0282  AC22 HEK-293T C317(0.99); C76(0.94); C14(0.98); C335(0.95)  LDD1521  [27]
 LDCM0283  AC23 HEK-293T C317(1.15); C76(0.98); C14(1.09); C335(0.96)  LDD1522  [27]
 LDCM0284  AC24 HEK-293T C317(0.95); C76(0.97); C14(0.98); C178(1.06)  LDD1523  [27]
 LDCM0285  AC25 HEK-293T C317(1.04); C76(0.92); C14(1.02); C178(0.91)  LDD1524  [27]
 LDCM0286  AC26 HEK-293T C317(1.17); C76(1.01); C14(1.03); C335(0.95)  LDD1525  [27]
 LDCM0287  AC27 HEK-293T C317(1.12); C76(0.95); C14(0.93); C335(1.18)  LDD1526  [27]
 LDCM0288  AC28 HEK-293T C317(1.05); C76(0.99); C14(0.95); C335(0.98)  LDD1527  [27]
 LDCM0289  AC29 HEK-293T C317(1.08); C76(0.89); C14(0.97); C335(1.00)  LDD1528  [27]
 LDCM0290  AC3 HEK-293T C317(1.17); C76(1.02); C14(0.92); C335(1.19)  LDD1529  [27]
 LDCM0291  AC30 HEK-293T C317(1.15); C76(1.00); C14(0.99); C335(1.08)  LDD1530  [27]
 LDCM0292  AC31 HEK-293T C317(0.98); C76(1.10); C14(1.01); C335(1.10)  LDD1531  [27]
 LDCM0293  AC32 HEK-293T C317(1.04); C76(1.03); C14(0.96); C178(0.91)  LDD1532  [27]
 LDCM0294  AC33 HEK-293T C317(0.94); C76(0.99); C14(0.95); C178(0.85)  LDD1533  [27]
 LDCM0295  AC34 HEK-293T C317(1.02); C76(1.07); C14(1.04); C335(1.06)  LDD1534  [27]
 LDCM0296  AC35 HEK-293T C317(0.95); C76(1.02); C14(0.85); C335(1.15)  LDD1535  [27]
 LDCM0297  AC36 HEK-293T C317(0.95); C76(1.02); C14(0.88); C335(1.02)  LDD1536  [27]
 LDCM0298  AC37 HEK-293T C317(1.04); C76(0.94); C14(0.94); C335(1.01)  LDD1537  [27]
 LDCM0299  AC38 HEK-293T C317(1.08); C76(1.07); C14(0.97); C335(0.92)  LDD1538  [27]
 LDCM0300  AC39 HEK-293T C317(1.07); C76(1.02); C14(1.04); C335(0.93)  LDD1539  [27]
 LDCM0301  AC4 HEK-293T C317(0.99); C76(1.10); C14(0.92); C335(1.04)  LDD1540  [27]
 LDCM0302  AC40 HEK-293T C317(1.03); C76(1.02); C14(0.89); C178(1.05)  LDD1541  [27]
 LDCM0303  AC41 HEK-293T C317(0.96); C76(0.90); C14(0.95); C178(0.89)  LDD1542  [27]
 LDCM0304  AC42 HEK-293T C317(1.08); C76(1.09); C14(1.07); C335(1.13)  LDD1543  [27]
 LDCM0305  AC43 HEK-293T C317(1.05); C76(0.94); C14(0.94); C335(1.11)  LDD1544  [27]
 LDCM0306  AC44 HEK-293T C317(0.97); C76(1.06); C14(0.89); C335(1.07)  LDD1545  [27]
 LDCM0307  AC45 HEK-293T C317(1.03); C76(0.95); C14(1.00); C335(1.03)  LDD1546  [27]
 LDCM0308  AC46 HEK-293T C317(1.04); C76(1.03); C14(0.95); C335(1.02)  LDD1547  [27]
 LDCM0309  AC47 HEK-293T C317(1.12); C76(1.08); C14(1.01); C335(0.99)  LDD1548  [27]
 LDCM0310  AC48 HEK-293T C317(0.97); C76(1.05); C14(0.91); C178(1.09)  LDD1549  [27]
 LDCM0311  AC49 HEK-293T C317(0.93); C76(0.89); C14(0.98); C178(0.83)  LDD1550  [27]
 LDCM0312  AC5 HEK-293T C317(1.09); C76(0.91); C14(1.04); C335(1.02)  LDD1551  [27]
 LDCM0313  AC50 HEK-293T C317(1.08); C76(1.01); C14(1.04); C335(0.99)  LDD1552  [27]
 LDCM0314  AC51 HEK-293T C317(0.97); C76(0.91); C14(0.90); C335(1.12)  LDD1553  [27]
 LDCM0315  AC52 HEK-293T C317(1.01); C76(1.03); C14(0.91); C335(0.99)  LDD1554  [27]
 LDCM0316  AC53 HEK-293T C317(1.02); C76(0.94); C14(0.99); C335(1.07)  LDD1555  [27]
 LDCM0317  AC54 HEK-293T C317(1.03); C76(1.04); C14(0.96); C335(0.98)  LDD1556  [27]
 LDCM0318  AC55 HEK-293T C317(1.04); C76(1.03); C14(1.00); C335(0.95)  LDD1557  [27]
 LDCM0319  AC56 HEK-293T C317(0.97); C76(1.09); C14(0.95); C178(1.10)  LDD1558  [27]
 LDCM0320  AC57 HEK-293T C317(1.00); C76(0.88); C14(0.97); C178(0.98)  LDD1559  [27]
 LDCM0321  AC58 HEK-293T C317(1.06); C76(1.11); C14(1.04); C335(1.09)  LDD1560  [27]
 LDCM0322  AC59 HEK-293T C317(1.09); C76(0.94); C14(0.90); C335(1.12)  LDD1561  [27]
 LDCM0323  AC6 HEK-293T C317(1.04); C76(1.05); C14(1.04); C335(0.97)  LDD1562  [27]
 LDCM0324  AC60 HEK-293T C317(0.97); C76(1.08); C14(0.92); C335(1.00)  LDD1563  [27]
 LDCM0325  AC61 HEK-293T C317(0.98); C76(0.96); C14(1.00); C335(1.11)  LDD1564  [27]
 LDCM0326  AC62 HEK-293T C317(1.05); C76(1.08); C14(0.94); C335(0.93)  LDD1565  [27]
 LDCM0327  AC63 HEK-293T C317(1.03); C76(1.09); C14(0.96); C335(1.01)  LDD1566  [27]
 LDCM0328  AC64 HEK-293T C317(1.04); C76(1.10); C14(0.95); C178(1.09)  LDD1567  [27]
 LDCM0334  AC7 HEK-293T C317(0.98); C76(1.16); C14(1.06); C335(0.93)  LDD1568  [27]
 LDCM0345  AC8 HEK-293T C317(1.04); C76(1.11); C14(0.98); C178(1.01)  LDD1569  [27]
 LDCM0248  AKOS034007472 HEK-293T C317(1.00); C76(0.93); C14(0.94); C335(0.99)  LDD1511  [27]
 LDCM0356  AKOS034007680 HEK-293T C317(1.01); C76(0.99); C14(1.01); C178(0.83)  LDD1570  [27]
 LDCM0275  AKOS034007705 HEK-293T C317(0.97); C76(1.00); C14(0.92); C178(1.06)  LDD1514  [27]
 LDCM0156  Aniline NCI-H1299 13.97  LDD0403  [1]
 LDCM0630  CCW28-3 231MFP C14(1.47)  LDD2214  [28]
 LDCM0632  CL-Sc Hep-G2 C14(3.38); C76(1.49); C107(1.21); C76(0.91)  LDD2227  [16]
 LDCM0367  CL1 HEK-293T C317(1.01); C76(0.80); C14(0.92)  LDD1571  [27]
 LDCM0368  CL10 HEK-293T C317(1.16); C76(0.59); C14(0.79); C335(1.02)  LDD1572  [27]
 LDCM0369  CL100 HEK-293T C317(1.11); C76(1.12); C14(1.03); C178(1.01)  LDD1573  [27]
 LDCM0370  CL101 HEK-293T C317(1.11); C76(0.87); C14(1.00)  LDD1574  [27]
 LDCM0371  CL102 HEK-293T C317(1.13); C76(0.93); C14(0.98); C335(1.07)  LDD1575  [27]
 LDCM0372  CL103 HEK-293T C317(0.98); C76(1.08); C14(1.03); C178(0.90)  LDD1576  [27]
 LDCM0373  CL104 HEK-293T C317(0.95); C76(1.02); C14(0.99); C178(0.97)  LDD1577  [27]
 LDCM0374  CL105 HEK-293T C317(1.00); C76(0.96); C14(1.03)  LDD1578  [27]
 LDCM0375  CL106 HEK-293T C317(1.06); C76(1.00); C14(0.95); C335(1.02)  LDD1579  [27]
 LDCM0376  CL107 HEK-293T C317(1.07); C76(1.02); C14(0.93); C178(0.92)  LDD1580  [27]
 LDCM0377  CL108 HEK-293T C317(0.95); C76(1.10); C14(1.00); C178(0.97)  LDD1581  [27]
 LDCM0378  CL109 HEK-293T C317(1.06); C76(0.87); C14(0.91)  LDD1582  [27]
 LDCM0379  CL11 HEK-293T C317(1.06); C76(0.65); C14(0.94); C335(0.81)  LDD1583  [27]
 LDCM0380  CL110 HEK-293T C317(0.98); C76(0.95); C14(0.97); C335(1.24)  LDD1584  [27]
 LDCM0381  CL111 HEK-293T C317(1.00); C76(0.92); C14(0.61); C178(1.09)  LDD1585  [27]
 LDCM0382  CL112 HEK-293T C317(1.06); C76(1.12); C14(1.03); C178(0.98)  LDD1586  [27]
 LDCM0383  CL113 HEK-293T C317(1.05); C76(0.85); C14(1.01)  LDD1587  [27]
 LDCM0384  CL114 HEK-293T C317(1.00); C76(0.89); C14(0.90); C335(1.11)  LDD1588  [27]
 LDCM0385  CL115 HEK-293T C317(1.09); C76(0.98); C14(1.05); C178(1.18)  LDD1589  [27]
 LDCM0386  CL116 HEK-293T C317(0.98); C76(1.20); C14(1.00); C178(1.12)  LDD1590  [27]
 LDCM0387  CL117 HEK-293T C317(1.07); C76(0.87); C14(1.01)  LDD1591  [27]
 LDCM0388  CL118 HEK-293T C317(0.98); C76(0.93); C14(0.96); C335(1.04)  LDD1592  [27]
 LDCM0389  CL119 HEK-293T C317(1.03); C76(1.06); C14(1.04); C178(1.05)  LDD1593  [27]
 LDCM0390  CL12 HEK-293T C317(1.01); C76(0.73); C14(1.11); C178(1.33)  LDD1594  [27]
 LDCM0391  CL120 HEK-293T C317(1.00); C76(1.02); C14(0.98); C178(1.03)  LDD1595  [27]
 LDCM0392  CL121 HEK-293T C317(1.07); C76(0.97); C14(1.00)  LDD1596  [27]
 LDCM0393  CL122 HEK-293T C317(0.99); C76(0.94); C14(1.00); C335(1.09)  LDD1597  [27]
 LDCM0394  CL123 HEK-293T C317(0.96); C76(0.93); C14(0.90); C178(0.91)  LDD1598  [27]
 LDCM0395  CL124 HEK-293T C317(0.99); C76(1.04); C14(1.05); C178(0.94)  LDD1599  [27]
 LDCM0396  CL125 HEK-293T C317(1.01); C76(0.80); C14(1.01)  LDD1600  [27]
 LDCM0397  CL126 HEK-293T C317(0.98); C76(0.88); C14(0.98); C335(0.99)  LDD1601  [27]
 LDCM0398  CL127 HEK-293T C317(1.09); C76(1.10); C14(1.03); C178(1.00)  LDD1602  [27]
 LDCM0399  CL128 HEK-293T C317(1.11); C76(1.17); C14(1.02); C178(0.97)  LDD1603  [27]
 LDCM0400  CL13 HEK-293T C317(0.98); C76(0.78); C14(0.99)  LDD1604  [27]
 LDCM0401  CL14 HEK-293T C317(1.04); C76(0.93); C14(1.00); C335(0.88)  LDD1605  [27]
 LDCM0402  CL15 HEK-293T C317(0.99); C76(1.01); C14(0.91); C178(1.01)  LDD1606  [27]
 LDCM0403  CL16 HEK-293T C317(1.07); C76(0.94); C14(1.06); C178(1.06)  LDD1607  [27]
 LDCM0404  CL17 HEK-293T C317(0.95); C76(0.89); C14(0.90); C178(0.77)  LDD1608  [27]
 LDCM0405  CL18 HEK-293T C317(1.16); C76(0.84); C14(1.07); C335(0.94)  LDD1609  [27]
 LDCM0406  CL19 HEK-293T C317(1.00); C76(1.13); C14(1.17); C335(0.96)  LDD1610  [27]
 LDCM0407  CL2 HEK-293T C317(0.98); C76(0.97); C14(1.00); C335(1.05)  LDD1611  [27]
 LDCM0408  CL20 HEK-293T C317(1.00); C76(0.79); C14(1.09); C335(0.83)  LDD1612  [27]
 LDCM0409  CL21 HEK-293T C317(0.98); C76(1.15); C14(0.73); C335(0.99)  LDD1613  [27]
 LDCM0410  CL22 HEK-293T C317(0.90); C76(0.55); C14(0.97); C335(0.83)  LDD1614  [27]
 LDCM0411  CL23 HEK-293T C317(0.98); C76(0.65); C14(0.85); C335(0.82)  LDD1615  [27]
 LDCM0412  CL24 HEK-293T C317(0.94); C76(0.69); C14(1.16); C178(1.21)  LDD1616  [27]
 LDCM0413  CL25 HEK-293T C317(1.01); C76(0.86); C14(0.93)  LDD1617  [27]
 LDCM0414  CL26 HEK-293T C317(0.99); C76(0.87); C14(1.01); C335(1.05)  LDD1618  [27]
 LDCM0415  CL27 HEK-293T C317(0.99); C76(0.97); C14(0.98); C178(0.95)  LDD1619  [27]
 LDCM0416  CL28 HEK-293T C317(1.11); C76(1.04); C14(1.04); C178(1.02)  LDD1620  [27]
 LDCM0417  CL29 HEK-293T C317(0.93); C76(1.01); C14(1.02); C178(0.83)  LDD1621  [27]
 LDCM0418  CL3 HEK-293T C317(1.02); C76(1.07); C14(1.06); C178(0.92)  LDD1622  [27]
 LDCM0419  CL30 HEK-293T C317(1.01); C76(0.92); C14(0.98); C335(1.04)  LDD1623  [27]
 LDCM0420  CL31 HEK-293T C317(1.04); C76(1.07); C14(1.18); C335(0.88)  LDD1624  [27]
 LDCM0421  CL32 HEK-293T C317(0.98); C76(0.81); C14(1.17); C335(0.86)  LDD1625  [27]
 LDCM0422  CL33 HEK-293T C317(0.92); C76(0.79); C14(0.70); C335(0.90)  LDD1626  [27]
 LDCM0423  CL34 HEK-293T C317(0.94); C76(0.59); C14(1.00); C335(0.90)  LDD1627  [27]
 LDCM0424  CL35 HEK-293T C317(0.97); C76(0.64); C14(0.90); C335(0.87)  LDD1628  [27]
 LDCM0425  CL36 HEK-293T C317(0.88); C76(0.63); C14(1.20); C178(1.31)  LDD1629  [27]
 LDCM0426  CL37 HEK-293T C317(1.00); C76(0.90); C14(0.98)  LDD1630  [27]
 LDCM0428  CL39 HEK-293T C317(1.22); C76(1.00); C14(0.97); C178(1.04)  LDD1632  [27]
 LDCM0429  CL4 HEK-293T C317(0.95); C76(1.06); C14(1.03); C178(0.85)  LDD1633  [27]
 LDCM0430  CL40 HEK-293T C317(1.12); C76(1.03); C14(1.03); C178(1.13)  LDD1634  [27]
 LDCM0431  CL41 HEK-293T C317(0.93); C76(1.06); C14(1.00); C178(0.84)  LDD1635  [27]
 LDCM0432  CL42 HEK-293T C317(1.11); C76(0.86); C14(1.06); C335(0.94)  LDD1636  [27]
 LDCM0433  CL43 HEK-293T C317(1.01); C76(1.25); C14(1.14); C335(0.99)  LDD1637  [27]
 LDCM0434  CL44 HEK-293T C317(0.95); C76(0.86); C14(1.13); C335(0.85)  LDD1638  [27]
 LDCM0435  CL45 HEK-293T C317(1.11); C76(1.22); C14(0.78); C335(0.87)  LDD1639  [27]
 LDCM0436  CL46 HEK-293T C317(1.02); C76(0.63); C14(1.02); C335(0.85)  LDD1640  [27]
 LDCM0437  CL47 HEK-293T C317(1.04); C76(0.65); C14(0.87); C335(0.83)  LDD1641  [27]
 LDCM0438  CL48 HEK-293T C317(0.92); C76(0.67); C14(1.21); C178(1.43)  LDD1642  [27]
 LDCM0439  CL49 HEK-293T C317(1.04); C76(0.80); C14(0.92)  LDD1643  [27]
 LDCM0440  CL5 HEK-293T C317(0.92); C76(0.94); C14(1.03); C178(0.81)  LDD1644  [27]
 LDCM0441  CL50 HEK-293T C317(1.05); C76(0.96); C14(0.91); C335(1.04)  LDD1645  [27]
 LDCM0443  CL52 HEK-293T C317(1.01); C76(1.08); C14(1.05); C178(1.03)  LDD1646  [27]
 LDCM0444  CL53 HEK-293T C317(0.98); C76(0.92); C14(0.95); C178(0.83)  LDD1647  [27]
 LDCM0445  CL54 HEK-293T C317(1.09); C76(0.82); C14(0.98); C335(0.96)  LDD1648  [27]
 LDCM0446  CL55 HEK-293T C317(1.13); C76(1.11); C14(1.20); C335(0.99)  LDD1649  [27]
 LDCM0447  CL56 HEK-293T C317(0.96); C76(0.81); C14(1.09); C335(0.85)  LDD1650  [27]
 LDCM0448  CL57 HEK-293T C317(1.09); C76(1.17); C14(0.70); C335(0.86)  LDD1651  [27]
 LDCM0449  CL58 HEK-293T C317(1.03); C76(0.58); C14(0.91); C335(0.89)  LDD1652  [27]
 LDCM0450  CL59 HEK-293T C317(1.13); C76(0.71); C14(0.82); C335(0.87)  LDD1653  [27]
 LDCM0451  CL6 HEK-293T C317(1.04); C76(0.90); C14(0.99); C335(1.00)  LDD1654  [27]
 LDCM0452  CL60 HEK-293T C317(0.86); C76(0.71); C14(1.15); C178(1.36)  LDD1655  [27]
 LDCM0453  CL61 HEK-293T C317(1.00); C76(0.83); C14(0.97)  LDD1656  [27]
 LDCM0454  CL62 HEK-293T C317(0.99); C76(0.95); C14(1.01); C335(1.09)  LDD1657  [27]
 LDCM0455  CL63 HEK-293T C317(1.10); C76(1.03); C14(1.04); C178(1.06)  LDD1658  [27]
 LDCM0456  CL64 HEK-293T C317(1.08); C76(0.94); C14(0.99); C178(1.00)  LDD1659  [27]
 LDCM0457  CL65 HEK-293T C317(1.00); C76(1.00); C14(0.94); C178(0.95)  LDD1660  [27]
 LDCM0458  CL66 HEK-293T C317(0.98); C76(0.92); C14(1.12); C335(0.99)  LDD1661  [27]
 LDCM0459  CL67 HEK-293T C317(1.05); C76(1.15); C14(1.12); C335(0.99)  LDD1662  [27]
 LDCM0460  CL68 HEK-293T C317(1.03); C76(0.86); C14(1.05); C335(0.89)  LDD1663  [27]
 LDCM0461  CL69 HEK-293T C317(1.04); C76(1.13); C14(0.76); C335(0.89)  LDD1664  [27]
 LDCM0462  CL7 HEK-293T C317(0.94); C76(1.05); C14(1.08); C335(1.00)  LDD1665  [27]
 LDCM0463  CL70 HEK-293T C317(1.12); C76(0.64); C14(0.98); C335(0.81)  LDD1666  [27]
 LDCM0464  CL71 HEK-293T C317(1.12); C76(0.66); C14(0.82); C335(0.88)  LDD1667  [27]
 LDCM0465  CL72 HEK-293T C317(0.91); C76(0.73); C14(1.15); C178(1.43)  LDD1668  [27]
 LDCM0466  CL73 HEK-293T C317(1.09); C76(0.86); C14(0.98)  LDD1669  [27]
 LDCM0467  CL74 HEK-293T C317(1.00); C76(1.00); C14(1.05); C335(1.01)  LDD1670  [27]
 LDCM0469  CL76 HEK-293T C317(1.02); C76(1.02); C14(0.97); C178(0.98)  LDD1672  [27]
 LDCM0470  CL77 HEK-293T C317(0.96); C76(0.97); C14(0.95); C178(0.88)  LDD1673  [27]
 LDCM0471  CL78 HEK-293T C317(1.08); C76(0.94); C14(1.07); C335(1.08)  LDD1674  [27]
 LDCM0472  CL79 HEK-293T C317(1.08); C76(1.06); C14(1.14); C335(0.98)  LDD1675  [27]
 LDCM0473  CL8 HEK-293T C317(0.90); C76(0.61); C14(0.86); C335(0.88)  LDD1676  [27]
 LDCM0474  CL80 HEK-293T C317(1.03); C76(0.87); C14(1.08); C335(0.92)  LDD1677  [27]
 LDCM0475  CL81 HEK-293T C317(1.04); C76(1.14); C14(0.81); C335(0.91)  LDD1678  [27]
 LDCM0476  CL82 HEK-293T C317(0.94); C76(0.68); C14(0.94); C335(0.90)  LDD1679  [27]
 LDCM0477  CL83 HEK-293T C317(1.09); C76(0.75); C14(0.91); C335(0.87)  LDD1680  [27]
 LDCM0478  CL84 HEK-293T C317(1.07); C76(0.83); C14(1.14); C178(1.57)  LDD1681  [27]
 LDCM0479  CL85 HEK-293T C317(1.09); C76(0.76); C14(1.01)  LDD1682  [27]
 LDCM0480  CL86 HEK-293T C317(1.00); C76(0.95); C14(0.94); C335(1.17)  LDD1683  [27]
 LDCM0481  CL87 HEK-293T C317(1.07); C76(1.22); C14(1.05); C178(0.90)  LDD1684  [27]
 LDCM0482  CL88 HEK-293T C317(1.03); C76(1.21); C14(1.04); C178(0.97)  LDD1685  [27]
 LDCM0483  CL89 HEK-293T C317(1.02); C76(0.99); C14(0.97); C178(0.95)  LDD1686  [27]
 LDCM0484  CL9 HEK-293T C317(0.99); C76(1.26); C14(0.77); C335(0.98)  LDD1687  [27]
 LDCM0485  CL90 HEK-293T C317(1.08); C76(0.98); C14(0.90); C335(1.17)  LDD1688  [27]
 LDCM0486  CL91 HEK-293T C317(1.18); C76(1.14); C14(1.14); C335(1.09)  LDD1689  [27]
 LDCM0487  CL92 HEK-293T C317(0.98); C76(1.02); C14(0.96); C335(0.91)  LDD1690  [27]
 LDCM0488  CL93 HEK-293T C317(1.00); C76(1.03); C14(0.79); C335(0.89)  LDD1691  [27]
 LDCM0489  CL94 HEK-293T C317(1.10); C76(0.79); C14(0.93); C335(0.97)  LDD1692  [27]
 LDCM0490  CL95 HEK-293T C317(1.03); C76(0.85); C14(0.92); C335(1.01)  LDD1693  [27]
 LDCM0491  CL96 HEK-293T C317(1.04); C76(1.05); C14(1.05); C178(1.28)  LDD1694  [27]
 LDCM0492  CL97 HEK-293T C317(0.97); C76(0.84); C14(0.98)  LDD1695  [27]
 LDCM0493  CL98 HEK-293T C317(0.94); C76(0.89); C14(1.06); C335(0.95)  LDD1696  [27]
 LDCM0494  CL99 HEK-293T C317(0.87); C76(1.05); C14(1.00); C178(0.92)  LDD1697  [27]
 LDCM0634  CY-0357 Hep-G2 C14(1.73)  LDD2228  [16]
 LDCM0495  E2913 HEK-293T C317(1.01); C76(1.04); C14(1.09); C178(1.11)  LDD1698  [27]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C14(1.03); C199(0.94); C218(0.81)  LDD1702  [2]
 LDCM0625  F8 Ramos C14(0.98)  LDD2187  [29]
 LDCM0572  Fragment10 Ramos C14(1.61)  LDD2189  [29]
 LDCM0573  Fragment11 Ramos C14(2.57)  LDD2190  [29]
 LDCM0574  Fragment12 Ramos C14(0.72)  LDD2191  [29]
 LDCM0575  Fragment13 Ramos C14(1.33)  LDD2192  [29]
 LDCM0576  Fragment14 Ramos C14(0.64)  LDD2193  [29]
 LDCM0579  Fragment20 Ramos C14(0.78)  LDD2194  [29]
 LDCM0580  Fragment21 Ramos C14(0.94)  LDD2195  [29]
 LDCM0582  Fragment23 Ramos C14(1.26)  LDD2196  [29]
 LDCM0578  Fragment27 Ramos C14(1.08)  LDD2197  [29]
 LDCM0586  Fragment28 Ramos C14(1.14)  LDD2198  [29]
 LDCM0588  Fragment30 Ramos C14(1.07)  LDD2199  [29]
 LDCM0589  Fragment31 Ramos C14(0.90)  LDD2200  [29]
 LDCM0590  Fragment32 Ramos C14(1.06)  LDD2201  [29]
 LDCM0468  Fragment33 HEK-293T C317(1.00); C76(1.06); C14(1.06); C178(0.99)  LDD1671  [27]
 LDCM0596  Fragment38 Ramos C14(0.96)  LDD2203  [29]
 LDCM0566  Fragment4 Ramos C14(0.55)  LDD2184  [29]
 LDCM0427  Fragment51 HEK-293T C317(1.06); C76(1.08); C14(1.00); C335(0.93)  LDD1631  [27]
 LDCM0610  Fragment52 Ramos C14(1.14)  LDD2204  [29]
 LDCM0614  Fragment56 Ramos C14(1.21)  LDD2205  [29]
 LDCM0569  Fragment7 Ramos C14(2.68)  LDD2186  [29]
 LDCM0571  Fragment9 Ramos C14(1.22)  LDD2188  [29]
 LDCM0116  HHS-0101 DM93 Y288(1.01)  LDD0264  [8]
 LDCM0117  HHS-0201 DM93 Y288(0.84)  LDD0265  [8]
 LDCM0118  HHS-0301 DM93 Y288(0.64)  LDD0266  [8]
 LDCM0119  HHS-0401 DM93 Y288(0.74)  LDD0267  [8]
 LDCM0120  HHS-0701 DM93 Y288(1.00)  LDD0268  [8]
 LDCM0124  JWB142 DM93 Y288(1.96)  LDD0286  [7]
 LDCM0125  JWB146 DM93 Y288(2.37)  LDD0287  [7]
 LDCM0126  JWB150 DM93 Y288(10.78)  LDD0288  [7]
 LDCM0127  JWB152 DM93 Y288(6.86)  LDD0289  [7]
 LDCM0128  JWB198 DM93 Y288(1.98)  LDD0290  [7]
 LDCM0129  JWB202 DM93 Y288(0.61)  LDD0291  [7]
 LDCM0179  JZ128 PC-3 N.A.  LDD0462  [5]
 LDCM0022  KB02 HEK-293T C14(0.95); C178(0.99); C317(0.87); C76(0.99)  LDD1492  [27]
 LDCM0023  KB03 Jurkat C76(7.42)  LDD0315  [12]
 LDCM0024  KB05 COLO792 C170(2.10); C330(2.13)  LDD3310  [4]
 LDCM0499  Nucleophilic fragment 12b MDA-MB-231 C14(1.04)  LDD2092  [2]
 LDCM0500  Nucleophilic fragment 13a MDA-MB-231 C107(1.13)  LDD2093  [2]
 LDCM0506  Nucleophilic fragment 16a MDA-MB-231 C107(0.99); C199(1.50)  LDD2099  [2]
 LDCM0514  Nucleophilic fragment 20a MDA-MB-231 C107(0.96); C199(1.34)  LDD2107  [2]
 LDCM0516  Nucleophilic fragment 21a MDA-MB-231 C107(0.85)  LDD2109  [2]
 LDCM0518  Nucleophilic fragment 22a MDA-MB-231 C107(1.25)  LDD2111  [2]
 LDCM0526  Nucleophilic fragment 26a MDA-MB-231 C107(2.04)  LDD2119  [2]
 LDCM0530  Nucleophilic fragment 28a MDA-MB-231 C107(1.15)  LDD2123  [2]
 LDCM0532  Nucleophilic fragment 29a MDA-MB-231 C107(1.48); C199(1.05)  LDD2125  [2]
 LDCM0536  Nucleophilic fragment 31 MDA-MB-231 C107(1.39)  LDD2129  [2]
 LDCM0543  Nucleophilic fragment 38 MDA-MB-231 C107(1.34)  LDD2136  [2]
 LDCM0544  Nucleophilic fragment 39 MDA-MB-231 C107(0.91)  LDD2137  [2]
 LDCM0546  Nucleophilic fragment 40 MDA-MB-231 C107(0.78)  LDD2140  [2]
 LDCM0550  Nucleophilic fragment 5a MDA-MB-231 C107(1.92); C199(2.47)  LDD2144  [2]
 LDCM0552  Nucleophilic fragment 6a MDA-MB-231 C107(0.95); C199(1.11)  LDD2146  [2]
 LDCM0556  Nucleophilic fragment 8a MDA-MB-231 C107(0.90)  LDD2150  [2]
 LDCM0627  NUDT7-COV-1 HEK-293T C14(2.12)  LDD2206  [30]
 LDCM0628  OTUB2-COV-1 HEK-293T C14(0.74)  LDD2207  [30]
 LDCM0131  RA190 MM1.R C14(0.95)  LDD0304  [31]
 LDCM0016  Ranjitkar_cp1 A431 3.60  LDD0074  [25]
 LDCM0019  Staurosporine Hep-G2 N.A.  LDD0083  [26]
 LDCM0021  THZ1 HeLa S3 C14(1.48)  LDD0460  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Glycogen [starch] synthase, muscle (GYS1) Glycosyltransferase 3 family P13807
cAMP-dependent protein kinase catalytic subunit alpha (PRKACA) AGC Ser/Thr protein kinase family P17612
RAC-alpha serine/threonine-protein kinase (AKT1) AGC Ser/Thr protein kinase family P31749
RAC-beta serine/threonine-protein kinase (AKT2) AGC Ser/Thr protein kinase family P31751
Leucine-rich repeat serine/threonine-protein kinase 2 (LRRK2) TKL Ser/Thr protein kinase family Q5S007
Tyrosine-protein kinase STYK1 (STYK1) Tyr protein kinase family Q6J9G0
E3 ubiquitin-protein ligase UBR5 (UBR5) . O95071
Tripartite motif-containing protein 29 (TRIM29) . Q14134
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
14-3-3 protein zeta/delta (YWHAZ) 14-3-3 family P63104
Amyloid-beta precursor protein (APP) APP family P05067
Cellular tumor antigen p53 (TP53) P53 family P04637
Alpha-synuclein (SNCA) Synuclein family P37840
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein ZFPM1 (ZFPM1) FOG (Friend of GATA) family Q8IX07
Zinc finger protein SNAI1 (SNAI1) Snail C2H2-type zinc-finger protein family O95863
Deformed epidermal autoregulatory factor 1 homolog (DEAF1) . O75398
Myc proto-oncogene protein (MYC) . P01106
Transcription factor RelB (RELB) . Q01201
Other
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Catenin beta-1 (CTNNB1) Beta-catenin family P35222
Protein bicaudal D homolog 1 (BICD1) BicD family Q96G01
Dapper homolog 1 (DACT1) Dapper family Q9NYF0
Translation initiation factor eIF2B subunit epsilon (EIF2B5) EIF-2B gamma/epsilon subunits family Q13144
Proto-oncogene FRAT1 (FRAT1) GSK-3-binding protein family Q92837
Low-density lipoprotein receptor-related protein 6 (LRP6) LDLR family O75581
RNA-binding protein FUS (FUS) RRM TET family P35637
Axin-1 (AXIN1) . O15169
Disabled homolog 2-interacting protein (DAB2IP) . Q5VWQ8
Microtubule-associated protein tau (MAPT) . P10636
Next to BRCA1 gene 1 protein (NBR1) . Q14596
Ninein (NIN) . Q8N4C6

The Drug(s) Related To This Target

Approved
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Fostamatinib Small molecular drug DB12010
Lithium Carbonate . DB14509
Lithium Citrate . DB14507
Phase 3
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Amo-02 . D0BS5E
Phase 2
Click To Hide/Show 5 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
9-ing-41 Small molecular drug D4USX5
Lithium Small molecular drug D5MF8Y
Ly2090314 Small molecular drug D0Z1DH
Tideglusib Small molecular drug D0UT7X
Neu-120 . D0D1UQ
Investigative
Click To Hide/Show 94 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Dm-204 Antibody D0WN1N
(2'z,3'e)-7-azaindirubin-3'-oxime Small molecular drug D07MZD
(2s)-1-(1h-indol-3-yl)-3-{[5-(3-methyl-1h-indazol-5-yl)Pyridin-3-yl]Oxy}Propan-2-amine Small molecular drug DB08073
(7s)-2-(2-aminopyrimidin-4-yl)-7-(2-fluoroethyl)-1567-tetrahydro-4h-pyrrolo[32-c]Pyridin-4-one Small molecular drug DB07149
(E)-n-(6-(Prop-1-enyl)-1h-indazol-3-yl)Butyramide Small molecular drug D09BQY
12,13-dehydro-8-o-acetylmanzamine A Small molecular drug D0E2XM
12,13-dehydromanzamine A Small molecular drug D0NL1F
3-(6-(Phenylamino)-9h-purin-8-yl)Benzonitrile Small molecular drug D0V6HG
3-phenyl-4-(Phenylamino)-1h-pyrrole-2,5-dione Small molecular drug D01OJG
4,5,6,7-tetrabromo-1h-benzo[D][1,2,3]Triazole Small molecular drug D0O1YH
4-(5-bromo-1h-indol-3-yl)Pyrimidin-2-amine Small molecular drug D0F5EI
4-[(3,5-diamino-1h-pyrazol-4-yl)Diazenyl]Phenol Small molecular drug D0A5RM
6-deoxymanzamine X Small molecular drug D09RYG
8-o-(4-bromobenzenesulfonyl)Manzamine F Small molecular drug D01RKI
8-o-(4-chlorobenzenesulfonyl)Manzamine F Small molecular drug D00AAN
8-o-(4-toluenesulfonyl)Manzamine A Small molecular drug D0X4KR
8-oh-manzamine A Small molecular drug D09ITI
9-n-ethyl-8-ethoxy-manzamine A Small molecular drug D0R7QL
9-n-methyl-8-methoxy-manzamine A Small molecular drug D0I3US
Alsterpaullone Small molecular drug DB04014
Alsterpaullone 2-cyanoethyl Small molecular drug D05NKG
Amp-pnp Small molecular drug D00ICA
Ar-ao-14418 Small molecular drug DB01950
As-601245 Small molecular drug D04QCF
Azakenpaullone Small molecular drug D0DR8N
Bisindolylmaleimide-i Small molecular drug D0TO6S
Bx-795 Small molecular drug D0RG0Z
Bx-912 Small molecular drug D0IX7Y
Chir-98014 Small molecular drug D04ZWF
Chir-98023 Small molecular drug D0X4CO
Ci-1040 Small molecular drug D0B9BU
Ct-98024 Small molecular drug D0Q3KS
Ellagic Acid Small molecular drug D0A1CM
Gsk-3beta Inhibitor Ii Small molecular drug D01MEP
Gsk-3beta Inhibitor Xi Small molecular drug D02ZIY
I-5 Small molecular drug D02OPH
Im-12 Small molecular drug D05SXF
Indirubin Deriv. 8a Small molecular drug D0B3ZB
Indirubin-3'-monoxime Small molecular drug DB02052
K00244 Small molecular drug D0Q7TO
L-779450 Small molecular drug D06WJA
Leucettamine B Small molecular drug D0K1DR
Lithium Cation Small molecular drug DB01356
Manzamine A Small molecular drug D0Q4QF
Manzamine E Small molecular drug D03GQF
Manzamine Y Small molecular drug D05GIC
N,8-diphenyl-9h-purin-6-amine Small molecular drug D00HUP
N-(6-(2-chlorophenyl)-1h-indazol-3-yl)Butyramide Small molecular drug D04ACJ
N-(6-(3-hydroxyphenyl)-1h-indazol-3-yl)Butyramide Small molecular drug D01IPF
N-(6-(4-aminophenyl)-1h-indazol-3-yl)Butyramide Small molecular drug D0A9MY
N-(6-(4-fluorophenyl)-1h-indazol-3-yl)Butyramide Small molecular drug D03OED
N-(6-(4-hydroxyphenyl)-1h-indazol-3-yl)Butyramide Small molecular drug D0S3RP
N-(6-(Furan-3-yl)-1h-indazol-3-yl)Butyramide Small molecular drug D0IL0G
N-(6-(Pyridin-3-yl)-1h-indazol-3-yl)Butyramide Small molecular drug D0R5EF
N-(6-(Pyridin-4-yl)-1h-indazol-3-yl)Butyramide Small molecular drug D0E6GC
N-(6-(Thiophen-3-yl)-1h-indazol-3-yl)Butyramide Small molecular drug D0T1CE
N-(6-(Trifluoromethyl)-1h-indazol-3-yl)Butyramide Small molecular drug D0C9OT
N-(6-benzyl-1h-indazol-3-yl)Butyramide Small molecular drug D07IVD
N-(6-bromo-1h-indazol-3-yl)Butyramide Small molecular drug D04VBD
N-(6-chloro-1h-indazol-3-yl)Butyramide Small molecular drug D0R6TL
N-(6-chloro-5-p-tolyl-1h-indazol-3-yl)Butyramide Small molecular drug D0M3SC
N-(6-chloro-5-phenyl-1h-indazol-3-yl)Butyramide Small molecular drug D0YM4A
N-(6-phenethyl-1h-indazol-3-yl)Butyramide Small molecular drug D06YMZ
N-(6-phenyl-1h-indazol-3-yl)Butyramide Small molecular drug D07PTD
N-(8-(3-cyanophenyl)-9h-purin-6-yl)Pentanamide Small molecular drug D00XUF
Neo-kauluamine Small molecular drug D09AEV
Nu-6102 Small molecular drug D0Y5RO
Paullone Small molecular drug D0D5ZL
Pf-228 Small molecular drug D02QAZ
Pmid19115845c89s Small molecular drug D0T8NU
Pyrazolopyridazine 1 Small molecular drug D02DLC
Pyrazolopyridazine 2 Small molecular drug D0O0VP
Quinoxaline1 Small molecular drug D0R5FH
Rgb-286147 Small molecular drug D0J4ON
Ro31-8220 Small molecular drug D0M5FF
Sb-409513 Small molecular drug DB01793
Sb-415286 Small molecular drug D0N4WB
Staurosporine Small molecular drug DB02010
Thieno Analogue Of Kenpaullone Small molecular drug D0TF9P
Tws-119 Small molecular drug D0T8KR
2-(13-benzodioxol-5-yl)-5-[(3-fluoro-4-methoxybenzyl)Sulfanyl]-134-oxadiazole . DB07014
3-({[(3s)-34-dihydroxybutyl]Oxy}Amino)-1h2'h-23'-biindol-2'-one . DB07676
3-[3-(23-dihydroxy-propylamino)-phenyl]-4-(5-fluoro-1-methyl-1h-indol-3-yl)-pyrrole-25-dione . DB01772
4-(4-chlorophenyl)-4-[4-(1h-pyrazol-4-yl)Phenyl]Piperidine . DB07859
5-(5-chloro-7h-pyrrolo[23-d]Pyrimidin-4-yl)-4567-tetrahydro-1h-imidazo[45-c]Pyridine . DB07585
5-[1-(4-methoxyphenyl)-1h-benzimidazol-6-yl]-134-oxadiazole-2(3h)-thione . DB07058
6-bromoindirubin-3'-oxime . DB03444
Cp-70949 . D0T8CQ
Isoquinoline-5-sulfonic Acid (2-(2-(4-chlorobenzyloxy)Ethylamino)Ethyl)Amide . DB07947
Lithium Succinate . DB14508
N-[(1s)-2-amino-1-phenylethyl]-5-(1h-pyrrolo[23-b]Pyridin-4-yl)Thiophene-2-carboxamide . DB07812
N-[2-(5-methyl-4h-124-triazol-3-yl)Phenyl]-7h-pyrrolo[23-d]Pyrimidin-4-amine . DB07584
Phosphoaminophosphonic Acid-adenylate Ester . DB04395
Staurosporinone . D0GB4V
Patented
Click To Hide/Show 5 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Ar-a014418 Small molecular drug D0A3MV
Chir-99021 Small molecular drug D0YK9D
Kenpaullone Small molecular drug D00PWQ
Pmid26161698-compound-18 Small molecular drug D0F7DS
Tdzd-8 Small molecular drug D06KNK
Discontinued
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Azd-1080 Small molecular drug D0MC0O
Ro-320432 Small molecular drug D0R5ZR
San-61 . D07YNH

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
3 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
4 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
5 A Chemoproteomic Strategy for Direct and Proteome-Wide Covalent Inhibitor Target-Site Identification. J Am Chem Soc. 2019 Jan 9;141(1):191-203. doi: 10.1021/jacs.8b07911. Epub 2018 Dec 20.
6 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
7 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
8 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
9 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
10 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
11 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
12 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
13 SP3-Enabled Rapid and High Coverage Chemoproteomic Identification of Cell-State-Dependent Redox-Sensitive Cysteines. Mol Cell Proteomics. 2022 Apr;21(4):100218. doi: 10.1016/j.mcpro.2022.100218. Epub 2022 Feb 25.
Mass spectrometry data entry: PXD029500 , PXD031647
14 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
15 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
16 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
17 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
18 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279
19 Site-Specific Activity-Based Protein Profiling Using Phosphonate Handles. Mol Cell Proteomics. 2023 Jan;22(1):100455. doi: 10.1016/j.mcpro.2022.100455. Epub 2022 Nov 24.
Mass spectrometry data entry: PXD036569
20 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
21 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
22 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
23 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
24 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
25 Affinity-based probes based on type II kinase inhibitors. J Am Chem Soc. 2012 Nov 21;134(46):19017-25. doi: 10.1021/ja306035v. Epub 2012 Nov 6.
26 Comprehensive identification of staurosporine-binding kinases in the hepatocyte cell line HepG2 using Capture Compound Mass Spectrometry (CCMS). J Proteome Res. 2010 Feb 5;9(2):806-17. doi: 10.1021/pr9007333.
27 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
28 Covalent Ligand Screening Uncovers a RNF4 E3 Ligase Recruiter for Targeted Protein Degradation Applications. ACS Chem Biol. 2019 Nov 15;14(11):2430-2440. doi: 10.1021/acschembio.8b01083. Epub 2019 May 13.
29 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
30 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.
31 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.