Details of the Target
General Information of Target
Target ID | LDTP01502 | |||||
---|---|---|---|---|---|---|
Target Name | NADH dehydrogenase 1 beta subcomplex subunit 6 (NDUFB6) | |||||
Gene Name | NDUFB6 | |||||
Gene ID | 4712 | |||||
Synonyms |
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; Complex I-B17; CI-B17; NADH-ubiquinone oxidoreductase B17 subunit |
|||||
3D Structure | ||||||
Sequence |
MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKM
VHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPM KEFPDQHH |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Complex I NDUFB6 subunit family
|
|||||
Subcellular location |
Mitochondrion inner membrane
|
|||||
Function |
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K24(6.51); K49(7.38); K54(0.37) | LDD0277 | [1] | |
NHS Probe Info |
![]() |
N.A. | LDD0010 | [2] | |
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [3] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C055 Probe Info |
![]() |
14.93 | LDD1752 | [4] | |
C056 Probe Info |
![]() |
47.18 | LDD1753 | [4] | |
C106 Probe Info |
![]() |
21.41 | LDD1793 | [4] | |
C201 Probe Info |
![]() |
23.92 | LDD1877 | [4] | |
C210 Probe Info |
![]() |
38.85 | LDD1884 | [4] | |
C218 Probe Info |
![]() |
11.79 | LDD1892 | [4] | |
C220 Probe Info |
![]() |
15.89 | LDD1894 | [4] | |
C278 Probe Info |
![]() |
61.39 | LDD1948 | [4] | |
C287 Probe Info |
![]() |
11.00 | LDD1957 | [4] | |
C289 Probe Info |
![]() |
46.53 | LDD1959 | [4] | |
C343 Probe Info |
![]() |
13.09 | LDD2005 | [4] | |
C362 Probe Info |
![]() |
91.14 | LDD2023 | [4] | |
C363 Probe Info |
![]() |
19.84 | LDD2024 | [4] | |
C364 Probe Info |
![]() |
18.25 | LDD2025 | [4] | |
C366 Probe Info |
![]() |
6.63 | LDD2027 | [4] | |
C388 Probe Info |
![]() |
37.27 | LDD2047 | [4] |
The Interaction Atlas With This Target
References