Details of the Target
General Information of Target
Target ID | LDTP11136 | |||||
---|---|---|---|---|---|---|
Target Name | Sugar transporter SWEET1 (SLC50A1) | |||||
Gene Name | SLC50A1 | |||||
Gene ID | 55974 | |||||
Synonyms |
RAG1AP1; SCP; Sugar transporter SWEET1; HsSWEET1; RAG1-activating protein 1; Solute carrier family 50 member 1; Stromal cell protein |
|||||
3D Structure | ||||||
Sequence |
MKITRQKHAKKHLGFFRNNFGVREPYQILLDGTFCQAALRGRIQLREQLPRYLMGETQLC
TTRCVLKELETLGKDLYGAKLIAQKCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVAT QDQNLSVKVKKKPGVPLMFIIQNTMVLDKPSPKTIAFVKAVESGQLVSVHEKESIKHLKE EQGLVKNTEQSRRKKRKKISGPNPLSCLKKKKKAPDTQSSASEKKRKRKRIRNRSNPKVL SEKQNAEGE |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
SWEET sugar transporter family
|
|||||
Subcellular location |
Golgi apparatus membrane
|
|||||
Function | Mediates sugar transport across membranes. May stimulate V(D)J recombination by the activation of RAG1. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
NAIA_5 Probe Info |
![]() |
C133(0.00); C176(0.00); C159(0.00) | LDD2223 | [1] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C153 Probe Info |
![]() |
39.12 | LDD1834 | [2] | |
C156 Probe Info |
![]() |
15.03 | LDD1836 | [2] | |
C159 Probe Info |
![]() |
23.92 | LDD1839 | [2] | |
C160 Probe Info |
![]() |
21.71 | LDD1840 | [2] | |
C161 Probe Info |
![]() |
19.03 | LDD1841 | [2] | |
C176 Probe Info |
![]() |
4.99 | LDD1855 | [2] | |
C210 Probe Info |
![]() |
42.81 | LDD1884 | [2] | |
C215 Probe Info |
![]() |
7.16 | LDD1889 | [2] | |
C217 Probe Info |
![]() |
7.26 | LDD1891 | [2] | |
C218 Probe Info |
![]() |
20.97 | LDD1892 | [2] | |
C219 Probe Info |
![]() |
15.24 | LDD1893 | [2] | |
C220 Probe Info |
![]() |
14.32 | LDD1894 | [2] | |
C250 Probe Info |
![]() |
5.17 | LDD1923 | [2] | |
C264 Probe Info |
![]() |
16.68 | LDD1935 | [2] | |
C266 Probe Info |
![]() |
14.52 | LDD1937 | [2] | |
C268 Probe Info |
![]() |
9.00 | LDD1938 | [2] | |
C270 Probe Info |
![]() |
11.31 | LDD1940 | [2] | |
BD-F Probe Info |
![]() |
K64(0.00); Y60(0.00) | LDD0024 | [3] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Syntenin-1 (SDCBP) | . | O00560 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Transcription termination factor 3, mitochondrial (MTERF3) | MTERF family | Q96E29 | |||
Nonsense-mediated mRNA decay factor SMG9 (SMG9) | SMG9 family | Q9H0W8 |
References