Details of the Target
General Information of Target
Target ID | LDTP16163 | |||||
---|---|---|---|---|---|---|
Target Name | Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial (COX16) | |||||
Gene Name | COX16 | |||||
Gene ID | 51241 | |||||
Synonyms |
C14orf112; Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial; hCOX16 |
|||||
3D Structure | ||||||
Sequence |
MASVVLALRTRTAVTSLLSPTPATALAVRYASKKSGGSSKNLGGKSSGRRQGIKKMEGHY
VHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRL PKGAVLYKTFVHVVPAKPEGTFKLVAML |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
COX16 family
|
|||||
Subcellular location |
Mitochondrion inner membrane
|
|||||
Function |
Required for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. Promotes the insertion of copper into the active site of cytochrome c oxidase subunit II (MT-CO2/COX2). Interacts specifically with newly synthesized MT-CO2/COX and its copper center-forming metallochaperones SCO1, SCO2 and COA6. Probably facilitates MT-CO2/COX2 association with the MITRAC assembly intermediate containing MT-CO1/COX1, thereby participating in merging the MT-CO1/COX1 and MT-CO2/COX2 assembly lines.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C159 Probe Info |
![]() |
20.11 | LDD1839 | [1] | |
C160 Probe Info |
![]() |
14.62 | LDD1840 | [1] | |
C161 Probe Info |
![]() |
39.40 | LDD1841 | [1] | |
C186 Probe Info |
![]() |
13.00 | LDD1864 | [1] | |
C285 Probe Info |
![]() |
99.73 | LDD1955 | [1] | |
C286 Probe Info |
![]() |
6.63 | LDD1956 | [1] | |
C287 Probe Info |
![]() |
43.71 | LDD1957 | [1] | |
C288 Probe Info |
![]() |
26.72 | LDD1958 | [1] | |
C289 Probe Info |
![]() |
99.73 | LDD1959 | [1] | |
C290 Probe Info |
![]() |
9.58 | LDD1960 | [1] | |
C373 Probe Info |
![]() |
5.31 | LDD2033 | [1] | |
C399 Probe Info |
![]() |
6.77 | LDD2058 | [1] | |
C403 Probe Info |
![]() |
22.47 | LDD2061 | [1] |
The Interaction Atlas With This Target