Details of the Target

General Information of Target

Target ID LDTP00416
Target Name CDP-diacylglycerol--inositol 3-phosphatidyltransferase (CDIPT)
Gene Name CDIPT
Gene ID 10423
Synonyms
PIS; PIS1; CDP-diacylglycerol--inositol 3-phosphatidyltransferase; EC 2.7.8.11; Phosphatidylinositol synthase; PI synthase; PtdIns synthase
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQG
TRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESH
KMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTA
PIALLKSLISVIHLITAARNMAALDAADRAKKK
Target Bioclass
Enzyme
Family
CDP-alcohol phosphatidyltransferase class-I family
Subcellular location
Endoplasmic reticulum membrane
Function
Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reaction. May thus act to reduce an excessive cellular PtdIns content. The exchange activity is due to the reverse reaction of PtdIns synthase and is dependent on CMP, which is tightly bound to the enzyme.
Uniprot ID
O14735
Ensemble ID
ENST00000219789.11
HGNC ID
HGNC:1769

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
22RV1 SNV: p.L188F .
COLO678 SNV: p.H108D .
HCT15 SNV: p.M1? .
LNCaP clone FGC SNV: p.Y135C .
MINO SNV: p.S187L .
SNU1 Deletion: p.S38del .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C-Sul
 Probe Info  		3.32  LDD0066  [1]
YN-1
 Probe Info  		100.00  LDD0444  [2]
STPyne
 Probe Info  		K121(6.93)  LDD2217  [3]
EA-probe
 Probe Info  		N.A.  LDD0440  [4]
ATP probe
 Probe Info  		N.A.  LDD0199  [5]
AOyne
 Probe Info  		15.00  LDD0443  [6]
PAL-AfBPP Probe
Click To Hide/Show 13 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C040
 Probe Info  		6.96  LDD1740  [7]
C091
 Probe Info  		10.93  LDD1782  [7]
C092
 Probe Info  		19.70  LDD1783  [7]
C094
 Probe Info  		29.24  LDD1785  [7]
C231
 Probe Info  		13.83  LDD1904  [7]
C285
 Probe Info  		19.84  LDD1955  [7]
C287
 Probe Info  		8.94  LDD1957  [7]
C289
 Probe Info  		36.50  LDD1959  [7]
C362
 Probe Info  		28.84  LDD2023  [7]
FFF probe14
 Probe Info  		20.00  LDD0477  [8]
FFF probe2
 Probe Info  		20.00  LDD0463  [8]
Alk-rapa
 Probe Info  		2.74  LDD0213  [9]
OEA-DA
 Probe Info  		6.25  LDD0046  [10]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0175  Ethacrynic acid HeLa N.A.  LDD0440  [4]
 LDCM0090  Rapamycin JHH-7 2.74  LDD0213  [9]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 13 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Aspartate--tRNA ligase, mitochondrial (DARS2) Class-II aminoacyl-tRNA synthetase family Q6PI48
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
NADH-cytochrome b5 reductase 3 (CYB5R3) Flavoprotein pyridine nucleotide cytochrome reductase family P00387
Probable glutathione peroxidase 8 (GPX8) Glutathione peroxidase family Q8TED1
Glutathione S-transferase 3, mitochondrial (MGST3) MAPEG family O14880
E3 ubiquitin-protein ligase RNF19B (RNF19B) RBR family Q6ZMZ0
17-beta-hydroxysteroid dehydrogenase 13 (HSD17B13) Short-chain dehydrogenases/reductases (SDR) family Q7Z5P4
ADP-ribosylation factor-like protein 13B (ARL13B) Arf family Q3SXY8
TLC domain-containing protein 4 (TLCD4) TLCD4 family Q96MV1
V-type proton ATPase subunit e 1 (ATP6V0E1) V-ATPase e1/e2 subunit family O15342
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Peptidyl-prolyl cis-trans isomerase FKBP7 (FKBP7) . Q9Y680
Transmembrane ascorbate-dependent reductase CYB561 (CYB561) . P49447
Transporter and channel
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
High affinity cationic amino acid transporter 1 (SLC7A1) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family P30825
Sodium-dependent organic anion transporter (SLC10A6) Bile acid:sodium symporter (BASS) family Q3KNW5
Gap junction beta-1 protein (GJB1) Connexin family P08034
Monocarboxylate transporter 2 (SLC16A7) Monocarboxylate porter (TC 2.A.1.13) family O60669
Aquaporin-2 (AQP2) MIP/aquaporin (TC 1.A.8) family P41181
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Membrane-spanning 4-domains subfamily A member 14 (MS4A14) MS4A family Q96JA4
Potassium channel subfamily K member 1 (KCNK1) Two pore domain potassium channel (TC 1.A.1.8) family O00180
Barttin (BSND) . Q8WZ55
Syntenin-1 (SDCBP) . O00560
Thioredoxin-related transmembrane protein 2 (TMX2) . Q9Y320
GPCR
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Free fatty acid receptor 2 (FFAR2) G-protein coupled receptor 1 family O15552
G-protein coupled receptor 151 (GPR151) G-protein coupled receptor 1 family Q8TDV0
Probable G-protein coupled receptor 101 (GPR101) G-protein coupled receptor 1 family Q96P66
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
Immunoglobulin
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Killer cell immunoglobulin-like receptor 2DL3 (KIR2DL3) Immunoglobulin superfamily P43628
Sialic acid-binding Ig-like lectin 12 (SIGLEC12) SIGLEC (sialic acid binding Ig-like lectin) family Q96PQ1
B-cell antigen receptor complex-associated protein alpha chain (CD79A) . P11912
Other
Click To Hide/Show 16 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CDGSH iron-sulfur domain-containing protein 2 (CISD2) CISD protein family Q8N5K1
Complexin-4 (CPLX4) Complexin/synaphin family Q7Z7G2
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein FAM209A (FAM209A) FAM209 family Q5JX71
Golgi membrane protein 1 (GOLM1) GOLM family Q8NBJ4
Translation initiation factor IF-3, mitochondrial (MTIF3) IF-3 family Q9H2K0
Protein jagunal homolog 1 (JAGN1) Jagunal family Q8N5M9
RELT-like protein 2 (RELL2) RELT family Q8NC24
Reticulophagy regulator 3 (RETREG3) RETREG family Q86VR2
Protein SCAI (SCAI) SCAI family Q8N9R8
Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21) VMA21 family Q3ZAQ7
Immediate early response 3-interacting protein 1 (IER3IP1) YOS1 family Q9Y5U9
Cell growth regulator with RING finger domain protein 1 (CGRRF1) . Q99675
Insulin-like growth factor-binding protein 6 (IGFBP6) . P24592
Outer dense fiber protein 4 (ODF4) . Q2M2E3
Reticulon-3 (RTN3) . O95197

The Drug(s) Related To This Target

Investigative
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Scyllo-inositol Small molecular drug DB03106

References

1 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
2 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
3 Global profiling of lysine reactivity and ligandability in the human proteome. Nat Chem. 2017 Dec;9(12):1181-1190. doi: 10.1038/nchem.2826. Epub 2017 Jul 31.
4 Chemoproteomic Profiling Reveals Ethacrynic Acid Targets Adenine Nucleotide Translocases to Impair Mitochondrial Function. Mol Pharm. 2018 Jun 4;15(6):2413-2422. doi: 10.1021/acs.molpharmaceut.8b00250. Epub 2018 May 15.
5 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
6 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
7 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
8 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
9 Rapamycin targets STAT3 and impacts c-Myc to suppress tumor growth. Cell Chem Biol. 2022 Mar 17;29(3):373-385.e6. doi: 10.1016/j.chembiol.2021.10.006. Epub 2021 Oct 26.
10 Mapping Protein Targets of Bioactive Small Molecules Using Lipid-Based Chemical Proteomics. ACS Chem Biol. 2017 Oct 20;12(10):2671-2681. doi: 10.1021/acschembio.7b00581. Epub 2017 Sep 20.
Mass spectrometry data entry: PXD007570