Details of the Target
General Information of Target
| Target ID | LDTP00416 | |||||
|---|---|---|---|---|---|---|
| Target Name | CDP-diacylglycerol--inositol 3-phosphatidyltransferase (CDIPT) | |||||
| Gene Name | CDIPT | |||||
| Gene ID | 10423 | |||||
| Synonyms |
PIS; PIS1; CDP-diacylglycerol--inositol 3-phosphatidyltransferase; EC 2.7.8.11; Phosphatidylinositol synthase; PI synthase; PtdIns synthase |
|||||
| 3D Structure | ||||||
| Sequence |
MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQG
TRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESH KMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTA PIALLKSLISVIHLITAARNMAALDAADRAKKK |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
CDP-alcohol phosphatidyltransferase class-I family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reaction. May thus act to reduce an excessive cellular PtdIns content. The exchange activity is due to the reverse reaction of PtdIns synthase and is dependent on CMP, which is tightly bound to the enzyme.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C-Sul Probe Info |
![]() |
3.32 | LDD0066 | [1] | |
|
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [2] | |
|
STPyne Probe Info |
![]() |
K121(6.93) | LDD2217 | [3] | |
|
EA-probe Probe Info |
![]() |
N.A. | LDD0440 | [4] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [5] | |
|
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [6] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C040 Probe Info |
![]() |
6.96 | LDD1740 | [7] | |
|
C091 Probe Info |
![]() |
10.93 | LDD1782 | [7] | |
|
C092 Probe Info |
![]() |
19.70 | LDD1783 | [7] | |
|
C094 Probe Info |
![]() |
29.24 | LDD1785 | [7] | |
|
C231 Probe Info |
![]() |
13.83 | LDD1904 | [7] | |
|
C285 Probe Info |
![]() |
19.84 | LDD1955 | [7] | |
|
C287 Probe Info |
![]() |
8.94 | LDD1957 | [7] | |
|
C289 Probe Info |
![]() |
36.50 | LDD1959 | [7] | |
|
C362 Probe Info |
![]() |
28.84 | LDD2023 | [7] | |
|
FFF probe14 Probe Info |
![]() |
20.00 | LDD0477 | [8] | |
|
FFF probe2 Probe Info |
![]() |
20.00 | LDD0463 | [8] | |
|
Alk-rapa Probe Info |
![]() |
2.74 | LDD0213 | [9] | |
|
OEA-DA Probe Info |
![]() |
6.25 | LDD0046 | [10] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
GPCR
Immunoglobulin
Other
References



















