Details of the Target
General Information of Target
Target ID | LDTP11229 | |||||
---|---|---|---|---|---|---|
Target Name | Transmembrane protein 70, mitochondrial (TMEM70) | |||||
Gene Name | TMEM70 | |||||
Gene ID | 54968 | |||||
Synonyms |
Transmembrane protein 70, mitochondrial |
|||||
3D Structure | ||||||
Sequence |
MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAY
AKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRF YLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPS GLTAAPTSLGSSDPPTSASQVAGTTGIAHRDLKPENILCESPEKVSPVKICDFDLGSGMK LNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKRCDLWSLGVVLYIMLSGYPP FVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLVRDAK QRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
TMEM70 family
|
|||||
Subcellular location |
Mitochondrion inner membrane
|
|||||
Function |
Scaffold protein that participates in the c-ring assembly of mitochondrial ATP synthase (F(1)F(0) ATP synthase or complex V) by facilitating the membrane insertion and oligomer formation of the subunit c/ATP5MC1 through its interaction. Therefore, participates in the early stage of mitochondrial ATP synthase biogenesis and also protects subunit c/ATP5MC1 against intramitochondrial proteolysis. In addition, binds the mitochondrial proton-transporting ATP synthase complexes I and may play a role in the stability of its membrane-bound subassemblies.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
m-APA Probe Info |
![]() |
9.35 | LDD0402 | [1] | |
N1 Probe Info |
![]() |
100.00 | LDD0242 | [2] | |
STPyne Probe Info |
![]() |
K206(5.81) | LDD2217 | [3] | |
EA-probe Probe Info |
![]() |
N.A. | LDD0440 | [4] | |
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [5] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [6] | |
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [7] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C027 Probe Info |
![]() |
5.78 | LDD1733 | [8] | |
C094 Probe Info |
![]() |
31.12 | LDD1785 | [8] | |
C106 Probe Info |
![]() |
19.16 | LDD1793 | [8] | |
C108 Probe Info |
![]() |
8.46 | LDD1795 | [8] | |
C112 Probe Info |
![]() |
21.86 | LDD1799 | [8] | |
C161 Probe Info |
![]() |
9.78 | LDD1841 | [8] | |
C187 Probe Info |
![]() |
17.51 | LDD1865 | [8] | |
C228 Probe Info |
![]() |
19.43 | LDD1901 | [8] | |
C289 Probe Info |
![]() |
36.25 | LDD1959 | [8] | |
C350 Probe Info |
![]() |
25.28 | LDD2011 | [8] | |
C362 Probe Info |
![]() |
30.70 | LDD2023 | [8] | |
C388 Probe Info |
![]() |
37.53 | LDD2047 | [8] | |
FFF probe11 Probe Info |
![]() |
20.00 | LDD0472 | [9] | |
FFF probe14 Probe Info |
![]() |
16.69 | LDD0477 | [9] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References