Details of the Target

General Information of Target

Target ID LDTP05437
Target Name Single-stranded DNA-binding protein, mitochondrial (SSBP1)
Gene Name SSBP1
Gene ID 6742
Synonyms
SSBP; Single-stranded DNA-binding protein, mitochondrial; Mt-SSB; MtSSB; PWP1-interacting protein 17
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLA
TNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYM
DKNNVRRQATTIIADNIIFLSDQTKEKE
Target Bioclass
Other
Subcellular location
Mitochondrion
Function
Binds preferentially and cooperatively to pyrimidine rich single-stranded DNA (ss-DNA). In vitro, required to maintain the copy number of mitochondrial DNA (mtDNA) and plays a crucial role during mtDNA replication by stimulating the activity of the replisome components POLG and TWNK at the replication fork. Promotes the activity of the gamma complex polymerase POLG, largely by organizing the template DNA and eliminating secondary structures to favor ss-DNA conformations that facilitate POLG activity. In addition it is able to promote the 5'-3' unwinding activity of the mtDNA helicase TWNK. May also function in mtDNA repair.
Uniprot ID
Q04837
Ensemble ID
ENST00000265304.11
HGNC ID
HGNC:11317

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 22 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C-Sul
 Probe Info  		4.48  LDD0066  [1]
TH211
 Probe Info  		Y119(20.00); Y73(9.58); Y101(6.12)  LDD0257  [2]
TH214
 Probe Info  		Y73(10.64)  LDD0258  [2]
TH216
 Probe Info  		Y119(20.00); Y73(9.54); Y101(6.59)  LDD0259  [2]
ONAyne
 Probe Info  		K81(10.00)  LDD0274  [3]
STPyne
 Probe Info  		K103(5.43); K122(10.00); K51(7.82); K81(2.63)  LDD0277  [3]
AZ-9
 Probe Info  		D77(10.00); E71(10.00)  LDD2209  [4]
OPA-S-S-alkyne
 Probe Info  		K81(4.93)  LDD3494  [5]
Probe 1
 Probe Info  		Y73(30.52); Y119(120.75)  LDD3495  [6]
HHS-482
 Probe Info  		Y101(0.75); Y119(1.19); Y73(0.96); Y99(0.90)  LDD0285  [7]
HHS-475
 Probe Info  		Y99(0.97); Y101(1.03); Y73(1.05); Y119(2.76)  LDD0264  [8]
HHS-465
 Probe Info  		Y119(10.00); Y73(10.00)  LDD2237  [9]
Acrolein
 Probe Info  		N.A.  LDD0221  [10]
AMP probe
 Probe Info  		N.A.  LDD0200  [11]
ATP probe
 Probe Info  		K122(0.00); K81(0.00); K103(0.00); K104(0.00)  LDD0199  [11]
Alkyne tyramide
 Probe Info  		Y119(0.00); Y73(0.00)  LDD0003  [12]
1d-yne
 Probe Info  		N.A.  LDD0356  [13]
NHS
 Probe Info  		K122(0.00); K81(0.00)  LDD0010  [12]
OSF
 Probe Info  		N.A.  LDD0029  [14]
SF
 Probe Info  		Y73(0.00); Y101(0.00); Y99(0.00)  LDD0028  [14]
Ox-W18
 Probe Info  		N.A.  LDD2175  [15]
1c-yne
 Probe Info  		K113(0.00); K51(0.00)  LDD0228  [13]
PAL-AfBPP Probe
Click To Hide/Show 10 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C087
 Probe Info  		8.94  LDD1779  [16]
C210
 Probe Info  		61.39  LDD1884  [16]
C338
 Probe Info  		11.39  LDD2001  [16]
C355
 Probe Info  		22.63  LDD2016  [16]
FFF probe13
 Probe Info  		15.12  LDD0475  [17]
FFF probe2
 Probe Info  		9.65  LDD0463  [17]
FFF probe3
 Probe Info  		8.21  LDD0464  [17]
JN0003
 Probe Info  		13.37  LDD0469  [17]
BD-F
 Probe Info  		N.A.  LDD0024  [18]
OEA-DA
 Probe Info  		5.17  LDD0046  [19]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [10]
 LDCM0116  HHS-0101 DM93 Y99(0.97); Y101(1.03); Y73(1.05); Y119(2.76)  LDD0264  [8]
 LDCM0117  HHS-0201 DM93 Y73(0.96); Y99(1.06); Y101(1.98); Y119(2.91)  LDD0265  [8]
 LDCM0118  HHS-0301 DM93 Y73(0.71); Y99(1.66); Y101(2.01); Y119(3.34)  LDD0266  [8]
 LDCM0119  HHS-0401 DM93 Y73(1.02); Y99(1.56); Y101(1.62); Y119(4.22)  LDD0267  [8]
 LDCM0120  HHS-0701 DM93 Y73(1.32); Y99(1.47); Y119(5.36); Y101(6.75)  LDD0268  [8]
 LDCM0107  IAA HeLa N.A.  LDD0221  [10]
 LDCM0123  JWB131 DM93 Y101(0.75); Y119(1.19); Y73(0.96); Y99(0.90)  LDD0285  [7]
 LDCM0124  JWB142 DM93 Y101(0.99); Y119(1.63); Y73(0.99); Y99(0.88)  LDD0286  [7]
 LDCM0125  JWB146 DM93 Y101(0.64); Y119(1.21); Y73(1.11); Y99(0.97)  LDD0287  [7]
 LDCM0126  JWB150 DM93 Y101(2.41); Y119(4.01); Y73(3.81); Y99(2.70)  LDD0288  [7]
 LDCM0127  JWB152 DM93 Y101(1.19); Y119(3.41); Y73(1.87); Y99(1.98)  LDD0289  [7]
 LDCM0128  JWB198 DM93 Y101(1.23); Y119(0.91); Y73(1.26); Y99(1.18)  LDD0290  [7]
 LDCM0129  JWB202 DM93 Y101(0.82); Y119(1.10); Y73(0.73); Y99(0.58)  LDD0291  [7]
 LDCM0130  JWB211 DM93 Y101(0.73); Y119(1.28); Y73(1.03); Y99(0.90)  LDD0292  [7]
 LDCM0109  NEM HeLa N.A.  LDD0223  [10]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
OTU domain-containing protein 6A (OTUD6A) . Q7L8S5
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Chorion-specific transcription factor GCMb (GCM2) . O75603
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Galectin-7 (LGALS7; LGALS7B) . P47929
Single-stranded DNA-binding protein, mitochondrial (SSBP1) . Q04837

References

1 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
2 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
3 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
4 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
5 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
6 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
7 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
8 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
9 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
10 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
11 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
12 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
13 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
14 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
15 Oxidative cyclization reagents reveal tryptophan cation- interactions. Nature. 2024 Mar;627(8004):680-687. doi: 10.1038/s41586-024-07140-6. Epub 2024 Mar 6.
Mass spectrometry data entry: PXD001377 , PXD005252
16 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
17 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
18 Evaluation of fully-functionalized diazirine tags for chemical proteomic applications. Chem Sci. 2021 May 7;12(22):7839-7847. doi: 10.1039/d1sc01360b.
Mass spectrometry data entry: PXD025652
19 Mapping Protein Targets of Bioactive Small Molecules Using Lipid-Based Chemical Proteomics. ACS Chem Biol. 2017 Oct 20;12(10):2671-2681. doi: 10.1021/acschembio.7b00581. Epub 2017 Sep 20.
Mass spectrometry data entry: PXD007570