Details of the Target

General Information of Target

Target ID LDTP05056
Target Name Eukaryotic translation initiation factor 5A-1 (EIF5A)
Gene Name EIF5A
Gene ID 1984
Synonyms
Eukaryotic translation initiation factor 5A-1; eIF-5A-1; eIF-5A1; Eukaryotic initiation factor 5A isoform 1; eIF-5A; Rev-binding factor; eIF-4D
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVG
IDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLG
KEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Target Type
Literature-reported
Target Bioclass
Transporter and channel
Family
EIF-5A family
Subcellular location
Cytoplasm
Function
Translation factor that promotes translation elongation and termination, particularly upon ribosome stalling at specific amino acid sequence contexts. Binds between the exit (E) and peptidyl (P) site of the ribosome and promotes rescue of stalled ribosome: specifically required for efficient translation of polyproline-containing peptides as well as other motifs that stall the ribosome. Acts as a ribosome quality control (RQC) cofactor by joining the RQC complex to facilitate peptidyl transfer during CAT tailing step. Also involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF-alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. Is required for autophagy by assisting the ribosome in translating the ATG3 protein at a specific amino acid sequence, the 'ASP-ASP-Gly' motif, leading to the increase of the efficiency of ATG3 translation and facilitation of LC3B lipidation and autophagosome formation.; (Microbial infection) Cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts.
TTD ID
T46929
Uniprot ID
P63241
DrugMap ID
TTIVCNR
Ensemble ID
ENST00000336452.11
HGNC ID
HGNC:3300
ChEMBL ID
CHEMBL4105862

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CCK81 SNV: p.T136A .
ICC137 SNV: p.R26H .
JURKAT SNV: p.A24V; p.R109Ter Compound 10    Probe Info 
MOLT4 SNV: p.R26H .
NUGC3 SNV: p.T136M .
OCUM1 SNV: p.P82R .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 44 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
A-EBA
 Probe Info  		50.00  LDD0214  [1]
CY-1
 Probe Info  		100.00  LDD0243  [2]
N1
 Probe Info  		5.84  LDD0242  [2]
TH211
 Probe Info  		Y69(11.52)  LDD0257  [3]
TH216
 Probe Info  		Y69(14.17)  LDD0259  [3]
YN-1
 Probe Info  		100.00  LDD0444  [4]
ONAyne
 Probe Info  		K121(1.33)  LDD0274  [5]
STPyne
 Probe Info  		K27(5.42); K39(2.39); K47(4.17); K55(8.71)  LDD0277  [5]
AZ-9
 Probe Info  		E42(0.86); E116(1.10); D118(1.13); R113(1.06)  LDD2208  [6]
IPM
 Probe Info  		N.A.  LDD0241  [7]
AHL-Pu-1
 Probe Info  		C129(2.01)  LDD0169  [8]
HHS-482
 Probe Info  		Y69(0.97)  LDD0285  [9]
HHS-475
 Probe Info  		Y69(0.89); Y98(1.11); Y127(20.00)  LDD0264  [10]
HHS-465
 Probe Info  		Y69(10.00); Y98(10.00)  LDD2237  [11]
5E-2FA
 Probe Info  		H77(0.00); H57(0.00)  LDD2235  [12]
AMP probe
 Probe Info  		K68(0.00); K67(0.00)  LDD0200  [13]
ATP probe
 Probe Info  		K68(0.00); K67(0.00); K85(0.00); K121(0.00)  LDD0199  [13]
m-APA
 Probe Info  		H77(0.00); H57(0.00)  LDD2231  [12]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [14]
IA-alkyne
 Probe Info  		C22(0.00); C73(0.00)  LDD0032  [15]
IPIAA_H
 Probe Info  		N.A.  LDD0030  [16]
IPIAA_L
 Probe Info  		C73(0.00); C22(0.00)  LDD0031  [16]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [14]
ATP probe
 Probe Info  		K121(0.00); K34(0.00); K67(0.00); K68(0.00)  LDD0035  [17]
BTD
 Probe Info  		N.A.  LDD0004  [18]
JW-RF-010
 Probe Info  		C73(0.00); C22(0.00); C38(0.00)  LDD0026  [19]
NAIA_4
 Probe Info  		C22(0.00); C73(0.00); C129(0.00)  LDD2226  [20]
TFBX
 Probe Info  		C38(0.00); C22(0.00); C73(0.00)  LDD0027  [19]
WYneO
 Probe Info  		N.A.  LDD0022  [18]
Compound 10
 Probe Info  		N.A.  LDD2216  [21]
Compound 11
 Probe Info  		N.A.  LDD2213  [21]
NHS
 Probe Info  		K121(0.00); K67(0.00)  LDD0010  [18]
PF-06672131
 Probe Info  		N.A.  LDD0152  [22]
VSF
 Probe Info  		C73(0.00); C22(0.00)  LDD0007  [18]
Phosphinate-6
 Probe Info  		C73(0.00); C38(0.00); C22(0.00)  LDD0018  [23]
1c-yne
 Probe Info  		K68(0.00); K85(0.00)  LDD0228  [24]
Acrolein
 Probe Info  		C73(0.00); H57(0.00); K68(0.00); H77(0.00)  LDD0217  [25]
Cinnamaldehyde
 Probe Info  		N.A.  LDD0220  [25]
Crotonaldehyde
 Probe Info  		C73(0.00); H57(0.00)  LDD0219  [25]
Methacrolein
 Probe Info  		C73(0.00); H57(0.00)  LDD0218  [25]
W1
 Probe Info  		C73(0.00); D62(0.00); H57(0.00)  LDD0236  [7]
MPP-AC
 Probe Info  		N.A.  LDD0428  [26]
NAIA_5
 Probe Info  		C129(0.00); C38(0.00); C73(0.00); C22(0.00)  LDD2223  [20]
TPP-AC
 Probe Info  		N.A.  LDD0427  [26]
PAL-AfBPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
FFF probe3
 Probe Info  		5.80  LDD0465  [27]
STS-1
 Probe Info  		N.A.  LDD0136  [28]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0502  1-(Cyanoacetyl)piperidine MDA-MB-231 C73(0.64)  LDD2095  [29]
 LDCM0537  2-Cyano-N,N-dimethylacetamide MDA-MB-231 C73(0.92)  LDD2130  [29]
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C73(0.97)  LDD2117  [29]
 LDCM0558  2-Cyano-N-phenylacetamide MDA-MB-231 C73(1.08)  LDD2152  [29]
 LDCM0539  3-(4-Isopropylpiperazin-1-yl)-3-oxopropanenitrile MDA-MB-231 C73(0.48)  LDD2132  [29]
 LDCM0538  4-(Cyanoacetyl)morpholine MDA-MB-231 C73(0.82)  LDD2131  [29]
 LDCM0025  4SU-RNA DM93 C129(2.15)  LDD0170  [8]
 LDCM0026  4SU-RNA+native RNA HEK-293T C129(2.01)  LDD0169  [8]
 LDCM0545  Acetamide MDA-MB-231 C73(0.81)  LDD2138  [29]
 LDCM0520  AKOS000195272 MDA-MB-231 C73(0.65)  LDD2113  [29]
 LDCM0498  BS-3668 MDA-MB-231 C73(0.88)  LDD2091  [29]
 LDCM0630  CCW28-3 231MFP C129(1.51); C73(1.47)  LDD2214  [30]
 LDCM0108  Chloroacetamide HeLa C73(0.00); C22(0.00); H57(0.00); H77(0.00)  LDD0222  [25]
 LDCM0632  CL-Sc Hep-G2 C73(4.14); C73(1.23); C73(0.23)  LDD2227  [20]
 LDCM0634  CY-0357 Hep-G2 C22(0.64); C73(0.40)  LDD2228  [20]
 LDCM0116  HHS-0101 DM93 Y69(0.89); Y98(1.11); Y127(20.00)  LDD0264  [10]
 LDCM0117  HHS-0201 DM93 Y69(0.71); Y98(1.13); Y127(20.00)  LDD0265  [10]
 LDCM0118  HHS-0301 DM93 Y69(0.68); Y98(0.71)  LDD0266  [10]
 LDCM0119  HHS-0401 DM93 Y69(0.77); Y98(0.92)  LDD0267  [10]
 LDCM0120  HHS-0701 DM93 Y98(0.73); Y69(0.97); Y127(20.00)  LDD0268  [10]
 LDCM0107  IAA HeLa C73(0.00); H57(0.00); C22(0.00); H77(0.00)  LDD0221  [25]
 LDCM0123  JWB131 DM93 Y69(0.97)  LDD0285  [9]
 LDCM0124  JWB142 DM93 Y69(0.62); Y98(0.96)  LDD0286  [9]
 LDCM0125  JWB146 DM93 Y69(1.37); Y98(1.28)  LDD0287  [9]
 LDCM0126  JWB150 DM93 Y69(7.18); Y98(5.49)  LDD0288  [9]
 LDCM0127  JWB152 DM93 Y69(8.88); Y98(3.03)  LDD0289  [9]
 LDCM0128  JWB198 DM93 Y69(3.84); Y98(2.73)  LDD0290  [9]
 LDCM0129  JWB202 DM93 Y69(0.87); Y98(0.66)  LDD0291  [9]
 LDCM0130  JWB211 DM93 Y69(1.38); Y98(1.42)  LDD0292  [9]
 LDCM0509  N-(4-bromo-3,5-dimethylphenyl)-2-nitroacetamide MDA-MB-231 C73(0.94)  LDD2102  [29]
 LDCM0528  N-(4-bromophenyl)-2-cyano-N-phenylacetamide MDA-MB-231 C73(1.05)  LDD2121  [29]
 LDCM0109  NEM HeLa C73(0.00); H57(0.00); H77(0.00)  LDD0223  [25]
 LDCM0496  Nucleophilic fragment 11a MDA-MB-231 C73(1.02)  LDD2089  [29]
 LDCM0497  Nucleophilic fragment 11b MDA-MB-231 C73(0.91)  LDD2090  [29]
 LDCM0499  Nucleophilic fragment 12b MDA-MB-231 C73(0.84)  LDD2092  [29]
 LDCM0500  Nucleophilic fragment 13a MDA-MB-231 C73(1.04)  LDD2093  [29]
 LDCM0501  Nucleophilic fragment 13b MDA-MB-231 C73(1.41)  LDD2094  [29]
 LDCM0503  Nucleophilic fragment 14b MDA-MB-231 C73(0.56)  LDD2096  [29]
 LDCM0504  Nucleophilic fragment 15a MDA-MB-231 C73(0.85)  LDD2097  [29]
 LDCM0505  Nucleophilic fragment 15b MDA-MB-231 C73(0.78)  LDD2098  [29]
 LDCM0506  Nucleophilic fragment 16a MDA-MB-231 C73(1.18)  LDD2099  [29]
 LDCM0508  Nucleophilic fragment 17a MDA-MB-231 C73(1.16)  LDD2101  [29]
 LDCM0511  Nucleophilic fragment 18b MDA-MB-231 C73(0.62)  LDD2104  [29]
 LDCM0513  Nucleophilic fragment 19b MDA-MB-231 C73(0.49)  LDD2106  [29]
 LDCM0514  Nucleophilic fragment 20a MDA-MB-231 C73(0.85)  LDD2107  [29]
 LDCM0516  Nucleophilic fragment 21a MDA-MB-231 C73(0.98)  LDD2109  [29]
 LDCM0517  Nucleophilic fragment 21b MDA-MB-231 C73(0.39)  LDD2110  [29]
 LDCM0518  Nucleophilic fragment 22a MDA-MB-231 C73(1.15)  LDD2111  [29]
 LDCM0521  Nucleophilic fragment 23b MDA-MB-231 C73(0.58)  LDD2114  [29]
 LDCM0522  Nucleophilic fragment 24a MDA-MB-231 C73(0.57)  LDD2115  [29]
 LDCM0526  Nucleophilic fragment 26a MDA-MB-231 C73(1.83)  LDD2119  [29]
 LDCM0529  Nucleophilic fragment 27b MDA-MB-231 C73(0.57)  LDD2122  [29]
 LDCM0530  Nucleophilic fragment 28a MDA-MB-231 C73(0.74)  LDD2123  [29]
 LDCM0532  Nucleophilic fragment 29a MDA-MB-231 C73(0.85)  LDD2125  [29]
 LDCM0534  Nucleophilic fragment 30a MDA-MB-231 C73(1.11)  LDD2127  [29]
 LDCM0535  Nucleophilic fragment 30b MDA-MB-231 C73(0.99)  LDD2128  [29]
 LDCM0536  Nucleophilic fragment 31 MDA-MB-231 C73(1.15)  LDD2129  [29]
 LDCM0541  Nucleophilic fragment 36 MDA-MB-231 C73(0.46)  LDD2134  [29]
 LDCM0542  Nucleophilic fragment 37 MDA-MB-231 C73(1.15)  LDD2135  [29]
 LDCM0543  Nucleophilic fragment 38 MDA-MB-231 C73(1.07)  LDD2136  [29]
 LDCM0544  Nucleophilic fragment 39 MDA-MB-231 C73(1.06)  LDD2137  [29]
 LDCM0211  Nucleophilic fragment 3b MDA-MB-231 C73(2.23)  LDD1700  [29]
 LDCM0546  Nucleophilic fragment 40 MDA-MB-231 C73(0.85)  LDD2140  [29]
 LDCM0547  Nucleophilic fragment 41 MDA-MB-231 C73(0.82)  LDD2141  [29]
 LDCM0549  Nucleophilic fragment 43 MDA-MB-231 C73(0.77)  LDD2143  [29]
 LDCM0550  Nucleophilic fragment 5a MDA-MB-231 C73(1.59)  LDD2144  [29]
 LDCM0552  Nucleophilic fragment 6a MDA-MB-231 C73(0.72)  LDD2146  [29]
 LDCM0553  Nucleophilic fragment 6b MDA-MB-231 C73(1.96)  LDD2147  [29]
 LDCM0554  Nucleophilic fragment 7a MDA-MB-231 C73(0.99)  LDD2148  [29]
 LDCM0556  Nucleophilic fragment 8a MDA-MB-231 C73(0.66)  LDD2150  [29]
 LDCM0557  Nucleophilic fragment 8b MDA-MB-231 C73(0.51)  LDD2151  [29]
 LDCM0559  Nucleophilic fragment 9b MDA-MB-231 C73(1.84)  LDD2153  [29]
 LDCM0627  NUDT7-COV-1 HEK-293T C22(1.00)  LDD2206  [31]
 LDCM0628  OTUB2-COV-1 HEK-293T C22(0.75)  LDD2207  [31]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Deoxyhypusine synthase (DHPS) Deoxyhypusine synthase family P49366
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Syntenin-1 (SDCBP) . O00560
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cone-rod homeobox protein (CRX) Paired homeobox family O43186
Homeobox protein goosecoid-2 (GSC2) Paired homeobox family O15499
Homeobox protein MOX-2 (MEOX2) . P50222
Proto-oncogene c-Rel (REL) . Q04864
Transcription factor LBX1 (LBX1) . P52954
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Meiosis-specific protein MEI4 (MEI4) MEI4L family A8MW99
PRKCA-binding protein (PICK1) . Q9NRD5

References

1 2-Ethynylbenzaldehyde-Based, Lysine-Targeting Irreversible Covalent Inhibitors for Protein Kinases and Nonkinases. J Am Chem Soc. 2023 Feb 12. doi: 10.1021/jacs.2c11595. Online ahead of print.
Mass spectrometry data entry: PXD037665
2 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.
3 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
4 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
5 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
6 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
7 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
8 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
9 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
10 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
11 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
12 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
13 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
14 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
15 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
16 SP3-Enabled Rapid and High Coverage Chemoproteomic Identification of Cell-State-Dependent Redox-Sensitive Cysteines. Mol Cell Proteomics. 2022 Apr;21(4):100218. doi: 10.1016/j.mcpro.2022.100218. Epub 2022 Feb 25.
Mass spectrometry data entry: PXD029500 , PXD031647
17 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
18 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
19 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
20 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
21 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279
22 Site-Specific Activity-Based Protein Profiling Using Phosphonate Handles. Mol Cell Proteomics. 2023 Jan;22(1):100455. doi: 10.1016/j.mcpro.2022.100455. Epub 2022 Nov 24.
Mass spectrometry data entry: PXD036569
23 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
24 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
25 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
26 Differently Tagged Probes for Protein Profiling of Mitochondria. Chembiochem. 2019 May 2;20(9):1155-1160. doi: 10.1002/cbic.201800735. Epub 2019 Mar 26.
27 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
28 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.
29 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
30 Covalent Ligand Screening Uncovers a RNF4 E3 Ligase Recruiter for Targeted Protein Degradation Applications. ACS Chem Biol. 2019 Nov 15;14(11):2430-2440. doi: 10.1021/acschembio.8b01083. Epub 2019 May 13.
31 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.