Details of the Target

General Information of Target

Target ID LDTP00463
Target Name Interferon-induced protein with tetratricopeptide repeats 3 (IFIT3)
Gene Name IFIT3
Gene ID 3437
Synonyms
CIG-49; IFI60; IFIT4; ISG60; Interferon-induced protein with tetratricopeptide repeats 3; IFIT-3; CIG49; ISG-60; Interferon-induced 60 kDa protein; IFI-60K; Interferon-induced protein with tetratricopeptide repeats 4; IFIT-4; Retinoic acid-induced gene G protein; P60; RIG-G
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYI
KHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKV
KQTCKKFSNPYSIEYSELDCEEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAM
YHLDNHPEKQFSTDVLKQAIELSPDNQYVKVLLGLKLQKMNKEAEGEQFVEEALEKSPCQ
TDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQIGCCYKAKVRQMQNTGESEA
SGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNKEVPDAEKQQS
HQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYL
QGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPR
ELLSNSEQLN
Target Bioclass
Other
Family
IFIT family
Subcellular location
Cytoplasm
Function
IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. Enhances MAVS-mediated host antiviral responses by serving as an adapter bridging TBK1 to MAVS which leads to the activation of TBK1 and phosphorylation of IRF3 and phosphorylated IRF3 translocates into nucleus to promote antiviral gene transcription. Exhibits an antiproliferative activity via the up-regulation of cell cycle negative regulators CDKN1A/p21 and CDKN1B/p27. Normally, CDKN1B/p27 turnover is regulated by COPS5, which binds CDKN1B/p27 in the nucleus and exports it to the cytoplasm for ubiquitin-dependent degradation. IFIT3 sequesters COPS5 in the cytoplasm, thereby increasing nuclear CDKN1B/p27 protein levels. Up-regulates CDKN1A/p21 by down-regulating MYC, a repressor of CDKN1A/p21. Can negatively regulate the apoptotic effects of IFIT2.
Uniprot ID
O14879
Ensemble ID
ENST00000371811.4
HGNC ID
HGNC:5411

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 10 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
CY-1
 Probe Info  		100.00  LDD0243  [1]
CY4
 Probe Info  		100.00  LDD0244  [1]
STPyne
 Probe Info  		K11(6.09); K119(10.00); K121(7.74); K197(7.50)  LDD0277  [2]
ONAyne
 Probe Info  		K119(10.00); K369(7.69)  LDD0275  [2]
BTD
 Probe Info  		C239(1.39)  LDD2089  [3]
DBIA
 Probe Info  		C283(0.97); C284(0.97); C39(0.90)  LDD0078  [4]
IA-alkyne
 Probe Info  		C343(0.00); C239(0.00)  LDD0036  [5]
NAIA_4
 Probe Info  		C39(0.00); C140(0.00); C239(0.00); C283(0.00)  LDD2226  [6]
IPM
 Probe Info  		C365(0.00); C283(0.00); C284(0.00); C239(0.00)  LDD0147  [7]
TFBX
 Probe Info  		C39(0.00); C239(0.00); C73(0.00)  LDD0148  [7]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STS-2
 Probe Info  		N.A.  LDD0139  [8]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0548  1-(4-(Benzo[d][1,3]dioxol-5-ylmethyl)piperazin-1-yl)-2-nitroethan-1-one MDA-MB-231 C239(0.69)  LDD2142  [3]
 LDCM0519  1-(6-methoxy-3,4-dihydroquinolin-1(2H)-yl)-2-nitroethan-1-one MDA-MB-231 C239(0.81)  LDD2112  [3]
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C239(1.07)  LDD2117  [3]
 LDCM0558  2-Cyano-N-phenylacetamide MDA-MB-231 C239(1.27)  LDD2152  [3]
 LDCM0020  ARS-1620 HCC44 C283(0.97); C284(0.97); C39(0.90)  LDD0078  [4]
 LDCM0630  CCW28-3 231MFP C39(1.84); C284(1.40); C343(1.17)  LDD2214  [9]
 LDCM0572  Fragment10 MDA-MB-231 C343(2.80)  LDD1389  [10]
 LDCM0573  Fragment11 MDA-MB-231 C343(2.55)  LDD1391  [10]
 LDCM0574  Fragment12 MDA-MB-231 C343(3.46)  LDD1468  [10]
 LDCM0575  Fragment13 MDA-MB-231 C343(1.49)  LDD1395  [10]
 LDCM0576  Fragment14 MDA-MB-231 C343(1.95)  LDD1397  [10]
 LDCM0579  Fragment20 MDA-MB-231 C343(5.06)  LDD1402  [10]
 LDCM0580  Fragment21 MDA-MB-231 C343(0.88)  LDD1404  [10]
 LDCM0581  Fragment22 MDA-MB-231 C343(2.10)  LDD1406  [10]
 LDCM0582  Fragment23 MDA-MB-231 C343(1.91)  LDD1408  [10]
 LDCM0584  Fragment25 MDA-MB-231 C343(0.80)  LDD1411  [10]
 LDCM0578  Fragment27 MDA-MB-231 C343(0.83)  LDD1401  [10]
 LDCM0586  Fragment28 MDA-MB-231 C343(1.10)  LDD1415  [10]
 LDCM0587  Fragment29 MDA-MB-231 C343(1.39)  LDD1417  [10]
 LDCM0588  Fragment30 MDA-MB-231 C343(1.44)  LDD1419  [10]
 LDCM0589  Fragment31 MDA-MB-231 C343(2.33)  LDD1421  [10]
 LDCM0590  Fragment32 MDA-MB-231 C343(2.11)  LDD1423  [10]
 LDCM0468  Fragment33 MDA-MB-231 C343(0.99)  LDD1425  [10]
 LDCM0593  Fragment35 MDA-MB-231 C343(0.92)  LDD1429  [10]
 LDCM0596  Fragment38 MDA-MB-231 C343(1.28)  LDD1433  [10]
 LDCM0597  Fragment39 MDA-MB-231 C343(1.14)  LDD1435  [10]
 LDCM0566  Fragment4 MDA-MB-231 C343(3.58)  LDD1378  [10]
 LDCM0598  Fragment40 MDA-MB-231 C343(0.60)  LDD1436  [10]
 LDCM0599  Fragment41 MDA-MB-231 C343(1.19)  LDD1438  [10]
 LDCM0601  Fragment43 MDA-MB-231 C343(1.32)  LDD1441  [10]
 LDCM0602  Fragment44 MDA-MB-231 C343(0.86)  LDD1443  [10]
 LDCM0603  Fragment45 MDA-MB-231 C343(3.98)  LDD1482  [10]
 LDCM0604  Fragment46 MDA-MB-231 C343(0.91)  LDD1445  [10]
 LDCM0608  Fragment50 MDA-MB-231 C343(3.36)  LDD1449  [10]
 LDCM0427  Fragment51 MDA-MB-231 C343(1.25)  LDD1483  [10]
 LDCM0610  Fragment52 MDA-MB-231 C343(1.00)  LDD1452  [10]
 LDCM0611  Fragment53 MDA-MB-231 C343(1.03)  LDD1454  [10]
 LDCM0612  Fragment54 MDA-MB-231 C343(1.12)  LDD1456  [10]
 LDCM0613  Fragment55 MDA-MB-231 C343(1.01)  LDD1457  [10]
 LDCM0614  Fragment56 MDA-MB-231 C343(1.63)  LDD1458  [10]
 LDCM0568  Fragment6 MDA-MB-231 C343(1.03)  LDD1382  [10]
 LDCM0569  Fragment7 MDA-MB-231 C343(1.47)  LDD1383  [10]
 LDCM0570  Fragment8 MDA-MB-231 C343(2.54)  LDD1385  [10]
 LDCM0571  Fragment9 MDA-MB-231 C343(1.56)  LDD1387  [10]
 LDCM0022  KB02 MDA-MB-231 C343(9.27)  LDD1374  [10]
 LDCM0023  KB03 MDA-MB-231 C343(5.72)  LDD1376  [10]
 LDCM0024  KB05 COLO792 C73(1.68); C239(2.07)  LDD3310  [11]
 LDCM0509  N-(4-bromo-3,5-dimethylphenyl)-2-nitroacetamide MDA-MB-231 C239(1.13)  LDD2102  [3]
 LDCM0528  N-(4-bromophenyl)-2-cyano-N-phenylacetamide MDA-MB-231 C239(1.10)  LDD2121  [3]
 LDCM0496  Nucleophilic fragment 11a MDA-MB-231 C239(1.39)  LDD2089  [3]
 LDCM0497  Nucleophilic fragment 11b MDA-MB-231 C239(1.70)  LDD2090  [3]
 LDCM0500  Nucleophilic fragment 13a MDA-MB-231 C239(0.99)  LDD2093  [3]
 LDCM0508  Nucleophilic fragment 17a MDA-MB-231 C239(0.65)  LDD2101  [3]
 LDCM0512  Nucleophilic fragment 19a MDA-MB-231 C239(1.15)  LDD2105  [3]
 LDCM0513  Nucleophilic fragment 19b MDA-MB-231 C239(0.71)  LDD2106  [3]
 LDCM0515  Nucleophilic fragment 20b MDA-MB-231 C239(0.92)  LDD2108  [3]
 LDCM0517  Nucleophilic fragment 21b MDA-MB-231 C239(1.05)  LDD2110  [3]
 LDCM0523  Nucleophilic fragment 24b MDA-MB-231 C239(1.16)  LDD2116  [3]
 LDCM0527  Nucleophilic fragment 26b MDA-MB-231 C158(0.97); C239(1.08)  LDD2120  [3]
 LDCM0531  Nucleophilic fragment 28b MDA-MB-231 C158(0.28); C239(1.11)  LDD2124  [3]
 LDCM0546  Nucleophilic fragment 40 MDA-MB-231 C239(0.59)  LDD2140  [3]
 LDCM0547  Nucleophilic fragment 41 MDA-MB-231 C239(0.63)  LDD2141  [3]
 LDCM0556  Nucleophilic fragment 8a MDA-MB-231 C239(1.06)  LDD2150  [3]
 LDCM0557  Nucleophilic fragment 8b MDA-MB-231 C158(0.68)  LDD2151  [3]
 LDCM0559  Nucleophilic fragment 9b MDA-MB-231 C239(2.03)  LDD2153  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
COP9 signalosome complex subunit 5 (COPS5) Peptidase M67A family Q92905
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Hsp90 co-chaperone Cdc37 (CDC37) CDC37 family Q16543
Other
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Deuterosome assembly protein 1 (DEUP1) CEP63 family Q05D60
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1) IFIT family P09914
Interferon-induced protein with tetratricopeptide repeats 1B (IFIT1B) IFIT family Q5T764
Interferon-induced protein with tetratricopeptide repeats 2 (IFIT2) IFIT family P09913
Interferon-induced protein with tetratricopeptide repeats 3 (IFIT3) IFIT family O14879
Transmembrane protein 183A (TMEM183A) TMEM183 family Q8IXX5
Tropomyosin alpha-3 chain (TPM3) Tropomyosin family P06753

References

1 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
4 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
5 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
6 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
7 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
8 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.
9 Covalent Ligand Screening Uncovers a RNF4 E3 Ligase Recruiter for Targeted Protein Degradation Applications. ACS Chem Biol. 2019 Nov 15;14(11):2430-2440. doi: 10.1021/acschembio.8b01083. Epub 2019 May 13.
10 Proteome-wide covalent ligand discovery in native biological systems. Nature. 2016 Jun 23;534(7608):570-4. doi: 10.1038/nature18002. Epub 2016 Jun 15.
11 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840