Details of the Target

General Information of Target

Target ID LDTP03332
Target Name Proteasome subunit alpha type-3 (PSMA3)
Gene Name PSMA3
Gene ID 5684
Synonyms
HC8; PSC8; Proteasome subunit alpha type-3; Macropain subunit C8; Multicatalytic endopeptidase complex subunit C8; Proteasome component C8
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL
QMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
Target Bioclass
Enzyme
Family
Peptidase T1A family
Subcellular location
Cytoplasm
Function
Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Binds to the C-terminus of CDKN1A and thereby mediates its degradation. Negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2.
Uniprot ID
P25788
Ensemble ID
ENST00000216455.9
HGNC ID
HGNC:9532
ChEMBL ID
CHEMBL2364701

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
22RV1 Deletion: p.A79del .
NCIH1793 SNV: p.K29M .
TOV21G Insertion: p.T221NfsTer2 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 31 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		9.33  LDD0402  [1]
N1
 Probe Info  		100.00  LDD0242  [2]
C-Sul
 Probe Info  		4.15  LDD0066  [3]
YN-1
 Probe Info  		100.00  LDD0444  [4]
STPyne
 Probe Info  		K57(5.76); K65(5.61)  LDD0277  [5]
ONAyne
 Probe Info  		N.A.  LDD0273  [5]
IPM
 Probe Info  		N.A.  LDD0241  [6]
OPA-S-S-alkyne
 Probe Info  		K65(1.97)  LDD3494  [7]
Probe 1
 Probe Info  		Y59(223.24)  LDD3495  [8]
BTD
 Probe Info  		C42(0.50)  LDD2091  [9]
HHS-482
 Probe Info  		Y59(0.96)  LDD0285  [10]
HHS-475
 Probe Info  		Y59(0.78)  LDD0264  [11]
Acrolein
 Probe Info  		N.A.  LDD0221  [12]
5E-2FA
 Probe Info  		H73(0.00); H111(0.00)  LDD2235  [13]
ATP probe
 Probe Info  		K57(0.00); K230(0.00); K206(0.00); K208(0.00)  LDD0199  [14]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [15]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [15]
IPIAA_H
 Probe Info  		N.A.  LDD0030  [16]
IPIAA_L
 Probe Info  		N.A.  LDD0031  [16]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [15]
ATP probe
 Probe Info  		N.A.  LDD0035  [17]
JW-RF-010
 Probe Info  		N.A.  LDD0026  [18]
NAIA_4
 Probe Info  		N.A.  LDD2226  [19]
TFBX
 Probe Info  		N.A.  LDD0027  [18]
NHS
 Probe Info  		N.A.  LDD0010  [20]
SF
 Probe Info  		Y59(0.00); Y8(0.00)  LDD0028  [21]
1c-yne
 Probe Info  		N.A.  LDD0228  [22]
MPP-AC
 Probe Info  		N.A.  LDD0428  [23]
NAIA_5
 Probe Info  		C42(0.00); C187(0.00)  LDD2223  [19]
TER-AC
 Probe Info  		N.A.  LDD0426  [23]
TPP-AC
 Probe Info  		N.A.  LDD0427  [23]
PAL-AfBPP Probe
Click To Hide/Show 7 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
FFF probe12
 Probe Info  		5.96  LDD0473  [24]
FFF probe13
 Probe Info  		6.71  LDD0475  [24]
FFF probe2
 Probe Info  		15.77  LDD0463  [24]
FFF probe3
 Probe Info  		12.64  LDD0464  [24]
VE-P
 Probe Info  		N.A.  LDD0396  [25]
OEA-DA
 Probe Info  		3.17  LDD0046  [26]
STS-1
 Probe Info  		N.A.  LDD0068  [27]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0502  1-(Cyanoacetyl)piperidine MDA-MB-231 C42(0.45)  LDD2095  [9]
 LDCM0539  3-(4-Isopropylpiperazin-1-yl)-3-oxopropanenitrile MDA-MB-231 C42(0.40)  LDD2132  [9]
 LDCM0538  4-(Cyanoacetyl)morpholine MDA-MB-231 C42(1.16)  LDD2131  [9]
 LDCM0498  BS-3668 MDA-MB-231 C42(0.50)  LDD2091  [9]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C42(0.10)  LDD1702  [9]
 LDCM0625  F8 Ramos C42(0.90)  LDD2187  [28]
 LDCM0572  Fragment10 Ramos C42(0.60)  LDD2189  [28]
 LDCM0573  Fragment11 Ramos C42(11.72)  LDD2190  [28]
 LDCM0574  Fragment12 Ramos C42(0.75)  LDD2191  [28]
 LDCM0575  Fragment13 Ramos C42(0.94)  LDD2192  [28]
 LDCM0576  Fragment14 Ramos C42(1.16)  LDD2193  [28]
 LDCM0579  Fragment20 Ramos C42(0.67)  LDD2194  [28]
 LDCM0580  Fragment21 Ramos C42(0.74)  LDD2195  [28]
 LDCM0582  Fragment23 Ramos C42(1.09)  LDD2196  [28]
 LDCM0578  Fragment27 Ramos C42(0.93)  LDD2197  [28]
 LDCM0586  Fragment28 Ramos C42(1.16)  LDD2198  [28]
 LDCM0588  Fragment30 Ramos C42(0.67)  LDD2199  [28]
 LDCM0589  Fragment31 Ramos C42(0.78)  LDD2200  [28]
 LDCM0590  Fragment32 Ramos C42(0.77)  LDD2201  [28]
 LDCM0468  Fragment33 Ramos C42(0.67)  LDD2202  [28]
 LDCM0596  Fragment38 Ramos C42(0.83)  LDD2203  [28]
 LDCM0566  Fragment4 Ramos C42(0.55)  LDD2184  [28]
 LDCM0610  Fragment52 Ramos C42(0.81)  LDD2204  [28]
 LDCM0614  Fragment56 Ramos C42(0.86)  LDD2205  [28]
 LDCM0569  Fragment7 Ramos C42(0.58)  LDD2186  [28]
 LDCM0571  Fragment9 Ramos C42(0.49)  LDD2188  [28]
 LDCM0149  GA MCF-7 C42(2.18)  LDD0379  [29]
 LDCM0116  HHS-0101 DM93 Y59(0.78)  LDD0264  [11]
 LDCM0117  HHS-0201 DM93 Y59(0.94)  LDD0265  [11]
 LDCM0118  HHS-0301 DM93 Y59(1.06)  LDD0266  [11]
 LDCM0119  HHS-0401 DM93 Y59(0.56)  LDD0267  [11]
 LDCM0120  HHS-0701 DM93 Y59(0.99)  LDD0268  [11]
 LDCM0107  IAA HeLa N.A.  LDD0221  [12]
 LDCM0123  JWB131 DM93 Y59(0.96)  LDD0285  [10]
 LDCM0124  JWB142 DM93 Y59(0.42)  LDD0286  [10]
 LDCM0126  JWB150 DM93 Y59(2.67)  LDD0288  [10]
 LDCM0127  JWB152 DM93 Y59(1.45)  LDD0289  [10]
 LDCM0128  JWB198 DM93 Y59(0.92)  LDD0290  [10]
 LDCM0129  JWB202 DM93 Y59(0.46)  LDD0291  [10]
 LDCM0022  KB02 Ramos C42(0.54)  LDD2182  [28]
 LDCM0023  KB03 Jurkat C42(11.92)  LDD0315  [30]
 LDCM0024  KB05 Ramos C42(0.50)  LDD2185  [28]
 LDCM0109  NEM HeLa N.A.  LDD0223  [12]
 LDCM0507  Nucleophilic fragment 16b MDA-MB-231 C42(1.03)  LDD2100  [9]
 LDCM0515  Nucleophilic fragment 20b MDA-MB-231 C42(0.77)  LDD2108  [9]
 LDCM0523  Nucleophilic fragment 24b MDA-MB-231 C42(0.12)  LDD2116  [9]
 LDCM0527  Nucleophilic fragment 26b MDA-MB-231 C42(0.66)  LDD2120  [9]
 LDCM0531  Nucleophilic fragment 28b MDA-MB-231 C42(0.15)  LDD2124  [9]
 LDCM0533  Nucleophilic fragment 29b MDA-MB-231 C42(0.23)  LDD2126  [9]
 LDCM0549  Nucleophilic fragment 43 MDA-MB-231 C42(0.83)  LDD2143  [9]
 LDCM0551  Nucleophilic fragment 5b MDA-MB-231 C42(0.16)  LDD2145  [9]
 LDCM0557  Nucleophilic fragment 8b MDA-MB-231 C42(0.05)  LDD2151  [9]
 LDCM0627  NUDT7-COV-1 HEK-293T C42(0.71)  LDD2206  [31]
 LDCM0628  OTUB2-COV-1 HEK-293T C42(0.70)  LDD2207  [31]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 13 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
NADH dehydrogenase flavoprotein 1, mitochondrial (NDUFV1) Complex I 51 kDa subunit family P49821
D-glutamate cyclase, mitochondrial (DGLUCY) D-glutamate cyclase family Q7Z3D6
E3 ubiquitin-protein ligase Mdm2 (MDM2) MDM2/MDM4 family Q00987
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Proteasome subunit alpha type-4 (PSMA4) Peptidase T1A family P25789
Proteasome subunit alpha type-6 (PSMA6) Peptidase T1A family P60900
Proteasome subunit alpha type-7 (PSMA7) Peptidase T1A family O14818
Proteasome subunit beta type-4 (PSMB4) Peptidase T1B family P28070
Tyrosine-protein phosphatase non-receptor type 23 (PTPN23) Protein-tyrosine phosphatase family Q9H3S7
Helicase ARIP4 (RAD54L2) SNF2/RAD54 helicase family Q9Y4B4
V-type proton ATPase 16 kDa proteolipid subunit c (ATP6V0C) V-ATPase proteolipid subunit family P27449
Protein PML (PML) . P29590
PWWP domain-containing protein 2B (PWWP2B) . Q6NUJ5
Transporter and channel
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Mitochondrial proton/calcium exchanger protein (LETM1) LETM1 family O95202
Melanoma inhibitory activity protein 2 (MIA2) MIA/OTOR family Q96PC5
Syntaxin-4 (STX4) Syntaxin family Q12846
Syntaxin-6 (STX6) Syntaxin family O43752
Wolframin (WFS1) . O76024
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Doublesex- and mab-3-related transcription factor 3 (DMRT3) DMRT family Q9NQL9
Protein odd-skipped-related 2 (OSR2) Odd C2H2-type zinc-finger protein family Q8N2R0
Endothelial transcription factor GATA-2 (GATA2) . P23769
Trans-acting T-cell-specific transcription factor GATA-3 (GATA3) . P23771
Zinc finger protein 366 (ZNF366) . Q8N895
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Neuropeptides B/W receptor type 2 (NPBWR2) G-protein coupled receptor 1 family P48146
Immunoglobulin
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Kin of IRRE-like protein 2 (KIRREL2) Immunoglobulin superfamily Q6UWL6
Butyrophilin subfamily 2 member A2 (BTN2A2) BTN/MOG family Q8WVV5
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
C-C motif chemokine 28 (CCL28) Intercrine beta (chemokine CC) family Q9NRJ3
Other
Click To Hide/Show 33 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Splicing factor 1 (SF1) BBP/SF1 family Q15637
Cystatin-SA (CST2) Cystatin family P09228
Protein FAM83A (FAM83A) FAM83 family Q86UY5
Golgi reassembly-stacking protein 2 (GORASP2) GORASP family Q9H8Y8
Keratin-associated protein 19-5 (KRTAP19-5) KRTAP type 19 family Q3LI72
Keratin-associated protein 8-1 (KRTAP8-1) KRTAP type 8 family Q8IUC2
Natriuretic peptides B (NPPB) Natriuretic peptide family P16860
Protein PAT1 homolog 1 (PATL1) PAT1 family Q86TB9
Keratin-associated protein 26-1 (KRTAP26-1) PMG family Q6PEX3
RNA guanine-N7 methyltransferase activating subunit (RAMAC) RAM family Q9BTL3
Meiotic recombination protein DMC1/LIM15 homolog (DMC1) RecA family Q14565
RNA-binding protein 42 (RBM42) RRM RBM42 family Q9BTD8
Guanine nucleotide exchange factor for Rab-3A (RAB3IL1) SEC2 family Q8TBN0
SLAIN motif-containing protein 1 (SLAIN1) SLAIN motif-containing family Q8ND83
Vacuolar protein sorting-associated protein 37C (VPS37C) VPS37 family A5D8V6
F-box only protein 7 (FBXO7) . Q9Y3I1
IQ domain-containing protein E (IQCE) . Q6IPM2
LIM and SH3 domain protein 1 (LASP1) . Q14847
Proline-rich protein 13 (PRR13) . Q9NZ81
Proline-rich protein 3 (PRR3) . P79522
Prostate collagen triple helix protein (PCOTH) . Q58A44
Protein crumbs homolog 3 (CRB3) . Q9BUF7
Protein FAM218A (FAM218A) . Q96MZ4
Putative uncharacterized protein encoded by LINC02913 (LINC02913) . Q8NAJ2
Putative uncharacterized protein KIRREL3-AS3 (KIRREL3-AS3) . Q8N7Y1
Putative uncharacterized protein MGC163334 . Q5W150
Putative uncharacterized protein RUSC1-AS1 (RUSC1-AS1) . Q66K80
Putative uncharacterized protein URB1-AS1 (URB1-AS1) . Q96HZ7
Receptor-transporting protein 5 (RTP5) . Q14D33
RNA binding protein fox-1 homolog 2 (RBFOX2) . O43251
Spermatogenesis-associated protein 8 (SPATA8) . Q6RVD6
Uncharacterized protein C1orf105 (C1orf105) . O95561
Zinc finger protein 385C (ZNF385C) . Q66K41

The Drug(s) Related To This Target

Investigative
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Phenethyl Isothiocyanate Small molecular drug DB12695
(3ar6r6as)-6-((S)-((S)-cyclohex-2-enyl)(Hydroxy)Methyl)-6a-methyl-4-oxo-hexahydro-2h-furo[32-c]Pyrrole-6-carbaldehyde . DB08515

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.
3 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
4 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
5 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
6 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
7 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
8 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
9 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
10 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
11 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
12 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
13 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
14 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
15 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
16 SP3-Enabled Rapid and High Coverage Chemoproteomic Identification of Cell-State-Dependent Redox-Sensitive Cysteines. Mol Cell Proteomics. 2022 Apr;21(4):100218. doi: 10.1016/j.mcpro.2022.100218. Epub 2022 Feb 25.
Mass spectrometry data entry: PXD029500 , PXD031647
17 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
18 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
19 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
20 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
21 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
22 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
23 Differently Tagged Probes for Protein Profiling of Mitochondria. Chembiochem. 2019 May 2;20(9):1155-1160. doi: 10.1002/cbic.201800735. Epub 2019 Mar 26.
24 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
25 Pharmacological Targeting of Vacuolar H(+)-ATPase via Subunit V1G Combats Multidrug-Resistant Cancer. Cell Chem Biol. 2020 Nov 19;27(11):1359-1370.e8. doi: 10.1016/j.chembiol.2020.06.011. Epub 2020 Jul 9.
26 Mapping Protein Targets of Bioactive Small Molecules Using Lipid-Based Chemical Proteomics. ACS Chem Biol. 2017 Oct 20;12(10):2671-2681. doi: 10.1021/acschembio.7b00581. Epub 2017 Sep 20.
Mass spectrometry data entry: PXD007570
27 Proteome profiling reveals potential cellular targets of staurosporine using a clickable cell-permeable probe. Chem Commun (Camb). 2011 Oct 28;47(40):11306-8. doi: 10.1039/c1cc14824a. Epub 2011 Sep 16.
28 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
29 Combined Omics Approach Identifies Gambogic Acid and Related Xanthones as Covalent Inhibitors of the Serine Palmitoyltransferase Complex. Cell Chem Biol. 2020 May 21;27(5):586-597.e12. doi: 10.1016/j.chembiol.2020.03.008. Epub 2020 Apr 23.
30 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
31 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.