Details of the Target
General Information of Target
| Target ID | LDTP01352 | |||||
|---|---|---|---|---|---|---|
| Target Name | PRA1 family protein 3 (ARL6IP5) | |||||
| Gene Name | ARL6IP5 | |||||
| Gene ID | 10550 | |||||
| Synonyms |
DERP11; JWA; PRA2; PRAF3; PRA1 family protein 3; ADP-ribosylation factor-like protein 6-interacting protein 5; ARL-6-interacting protein 5; Aip-5; Cytoskeleton-related vitamin A-responsive protein; Dermal papilla-derived protein 11; GTRAP3-18; Glutamate transporter EAAC1-interacting protein; JM5; Prenylated Rab acceptor protein 2; Protein JWa; Putative MAPK-activating protein PM27
|
|||||
| 3D Structure | ||||||
| Sequence |
MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGF
LSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLT DYISKVKE |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
PRA1 family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Regulates intracellular concentrations of taurine and glutamate. Negatively modulates SLC1A1/EAAC1 glutamate transport activity by decreasing its affinity for glutamate in a PKC activity-dependent manner. Plays a role in the retention of SLC1A1/EAAC1 in the endoplasmic reticulum.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TH211 Probe Info |
![]() |
Y182(12.62) | LDD0260 | [1] | |
|
TH216 Probe Info |
![]() |
Y182(20.00) | LDD0259 | [1] | |
|
OPA-S-S-alkyne Probe Info |
![]() |
K31(0.95); K158(2.70) | LDD3494 | [2] | |
|
Probe 1 Probe Info |
![]() |
Y182(15.12) | LDD3495 | [3] | |
|
Jackson_14 Probe Info |
![]() |
2.00 | LDD0123 | [4] | |
|
HPAP Probe Info |
![]() |
3.08 | LDD0062 | [5] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [6] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0035 | [7] | |
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [8] | |
|
STPyne Probe Info |
![]() |
N.A. | LDD0009 | [9] | |
|
MPP-AC Probe Info |
![]() |
N.A. | LDD0428 | [10] | |
|
TER-AC Probe Info |
![]() |
N.A. | LDD0426 | [10] | |
|
TPP-AC Probe Info |
![]() |
N.A. | LDD0427 | [10] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C027 Probe Info |
![]() |
5.90 | LDD1733 | [11] | |
|
C040 Probe Info |
![]() |
6.41 | LDD1740 | [11] | |
|
C094 Probe Info |
![]() |
30.27 | LDD1785 | [11] | |
|
C231 Probe Info |
![]() |
15.45 | LDD1904 | [11] | |
|
C235 Probe Info |
![]() |
26.72 | LDD1908 | [11] | |
|
C289 Probe Info |
![]() |
25.81 | LDD1959 | [11] | |
|
C349 Probe Info |
![]() |
10.20 | LDD2010 | [11] | |
|
C350 Probe Info |
![]() |
23.43 | LDD2011 | [11] | |
|
STS-1 Probe Info |
![]() |
N.A. | LDD0137 | [12] | |
|
OEA-DA Probe Info |
![]() |
3.15 | LDD0046 | [13] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References























