Details of the Target
General Information of Target
| Target ID | LDTP01309 | |||||
|---|---|---|---|---|---|---|
| Target Name | Renin receptor (ATP6AP2) |
|
||||
| Gene Name | ATP6AP2 | |||||
| Gene ID | 10159 | |||||
| Synonyms |
ATP6IP2; CAPER; ELDF10; Renin receptor; ATPase H(+)-transporting lysosomal accessory protein 2; ATPase H(+)-transporting lysosomal-interacting protein 2; ER-localized type I transmembrane adapter; Embryonic liver differentiation factor 10; N14F; Renin/prorenin receptor; Vacuolar ATP synthase membrane sector-associated protein M8-9; ATP6M8-9; V-ATPase M8.9 subunit) [Cleaved into: Renin receptor N-terminal fragment; Renin receptor C-terminal fragment]
|
|||||
| 3D Structure | ||||||
| Sequence |
MAVFVVLLALVAGVLGNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSW
PGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEE TPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVD LLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKIL VDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYN FEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Multifunctional protein which functions as a renin, prorenin cellular receptor and is involved in the assembly of the lysosomal proton-transporting V-type ATPase (V-ATPase) and the acidification of the endo-lysosomal system. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, may also play a role in the renin-angiotensin system (RAS). Through its function in V-type ATPase (v-ATPase) assembly and acidification of the lysosome it regulates protein degradation and may control different signaling pathways important for proper brain development, synapse morphology and synaptic transmission.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K346(0.71) | LDD0277 | [1] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C055 Probe Info |
 |
12.04 | LDD1752 | [2] | |
|
C056 Probe Info |
 |
18.00 | LDD1753 | [2] | |
|
C108 Probe Info |
 |
7.94 | LDD1795 | [2] | |
|
C161 Probe Info |
 |
10.27 | LDD1841 | [2] | |
|
C198 Probe Info |
 |
11.08 | LDD1874 | [2] | |
|
C201 Probe Info |
 |
24.42 | LDD1877 | [2] | |
|
C289 Probe Info |
 |
28.84 | LDD1959 | [2] | |
|
C310 Probe Info |
 |
8.88 | LDD1977 | [2] | |
|
C355 Probe Info |
 |
23.10 | LDD2016 | [2] | |
|
C362 Probe Info |
 |
49.18 | LDD2023 | [2] | |
|
C364 Probe Info |
 |
18.13 | LDD2025 | [2] | |
|
C388 Probe Info |
 |
38.32 | LDD2047 | [2] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Other
References