Details of the Target
General Information of Target
Target ID | LDTP00913 | |||||
---|---|---|---|---|---|---|
Target Name | Mitochondrial import inner membrane translocase subunit Tim8 A (TIMM8A) | |||||
Gene Name | TIMM8A | |||||
Gene ID | 1678 | |||||
Synonyms |
DDP; DDP1; TIM8A; Mitochondrial import inner membrane translocase subunit Tim8 A; Deafness dystonia protein 1; X-linked deafness dystonia protein |
|||||
3D Structure | ||||||
Sequence |
MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAE
ACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD |
|||||
Target Bioclass |
Other
|
|||||
Family |
Small Tim family
|
|||||
Subcellular location |
Mitochondrion inner membrane
|
|||||
Function |
Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins. Probably necessary for normal neurologic development.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
ONAyne Probe Info |
![]() |
K86(0.51) | LDD0274 | [1] | |
Acrolein Probe Info |
![]() |
C43(0.00); C66(0.00) | LDD0222 | [2] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0032 | [3] | |
JW-RF-010 Probe Info |
![]() |
N.A. | LDD0026 | [4] | |
TFBX Probe Info |
![]() |
C62(0.00); C66(0.00) | LDD0027 | [4] | |
Phosphinate-6 Probe Info |
![]() |
N.A. | LDD0018 | [5] | |
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [2] | |
NAIA_5 Probe Info |
![]() |
C66(0.00); C62(0.00); C47(0.00); C43(0.00) | LDD2223 | [6] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C106 Probe Info |
![]() |
24.76 | LDD1793 | [7] | |
C108 Probe Info |
![]() |
8.46 | LDD1795 | [7] | |
C232 Probe Info |
![]() |
37.27 | LDD1905 | [7] | |
C293 Probe Info |
![]() |
20.11 | LDD1963 | [7] | |
C296 Probe Info |
![]() |
14.32 | LDD1966 | [7] | |
C313 Probe Info |
![]() |
15.14 | LDD1980 | [7] | |
C314 Probe Info |
![]() |
13.55 | LDD1981 | [7] | |
C343 Probe Info |
![]() |
12.04 | LDD2005 | [7] | |
C348 Probe Info |
![]() |
11.47 | LDD2009 | [7] | |
C349 Probe Info |
![]() |
10.70 | LDD2010 | [7] | |
C350 Probe Info |
![]() |
37.53 | LDD2011 | [7] | |
C354 Probe Info |
![]() |
7.26 | LDD2015 | [7] | |
C362 Probe Info |
![]() |
25.28 | LDD2023 | [7] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
mRNA export factor GLE1 (GLE1) | GLE1 family | Q53GS7 | |||
Huntingtin (HTT) | Huntingtin family | P42858 | |||
Wolframin (WFS1) | . | O76024 |
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
AT-rich interactive domain-containing protein 3A (ARID3A) | . | Q99856 |
Other
References