Details of the Target

General Information of Target

Target ID LDTP19892
Target Name DGAT1/2-independent enzyme synthesizing storage lipids (TMEM68)
Gene Name TMEM68
Gene ID 137695
Synonyms
DGAT1/2-independent enzyme synthesizing storage lipids; DIESL; EC 2.3.1.-; 2-acylglycerol/1,2-diacylglycerol O-acyltransferase; Monoacylglycerol/Diacylglycerol O-acyltransferase; MGAT/DGAT; EC 2.3.1.20, EC 2.3.1.22; Transmembrane protein 68
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSK
YKPLSKPKKCVKCLQKTVKDSYHIMCRPCACELEVCAKCGKKEDIVIPWSLPLLPRLECS
GRILAHHNLRLPCSSDSPASASRVAGTTGAHHHAQLIFVFLVEMGFHYVGQAGLELLTS
Target Bioclass
Enzyme
Subcellular location
Membrane
Function
Catalytic subunit of the alternative triglyceride biosynthesis pathway, which mediates formation of triacylglycerol from diacylglycerol and membrane phospholipids. Synthesizes triacylglycerol at the expense of membrane phospholipids, such as phosphatidylcholine (PC) and its ether-linked form (ePC), thereby altering the composition of membranes. The alternative triglyceride biosynthesis pathway is probably required to provide the energy required for rapid growth when fuel sources are limiting. It maintains mitochondrial function during periods of extracellular lipid starvation. Can also use acyl-CoA as donor: acts as a acyl-CoA:monoacylglycerol acyltransferase (MGAT), but also shows acyl-CoA:diacylglycerol acyltransferase (DGAT) activity.
Uniprot ID
Q96MH6
Ensemble ID
ENST00000334667.6
HGNC ID
HGNC:26510

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
KASUMI1 SNV: p.V213I .
NCIH1155 Deletion: p.S317TfsTer19 DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 10 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		9.28  LDD0402  [1]
STPyne
 Probe Info  		K307(8.91)  LDD0277  [2]
DBIA
 Probe Info  		C183(1.57)  LDD3311  [3]
Jackson_1
 Probe Info  		2.56  LDD0120  [4]
Jackson_14
 Probe Info  		3.33  LDD0123  [4]
Johansson_61
 Probe Info  		_(5.34)  LDD1485  [5]
HPAP
 Probe Info  		3.26  LDD0063  [6]
Alkyne-RA190
 Probe Info  		4.71  LDD0299  [7]
IA-alkyne
 Probe Info  		N.A.  LDD0165  [8]
AOyne
 Probe Info  		15.00  LDD0443  [9]
PAL-AfBPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C053
 Probe Info  		14.72  LDD1751  [10]
C112
 Probe Info  		62.68  LDD1799  [10]
C407
 Probe Info  		23.10  LDD2064  [10]
FFF probe11
 Probe Info  		20.00  LDD0472  [11]
FFF probe14
 Probe Info  		20.00  LDD0477  [11]
OEA-DA
 Probe Info  		3.92  LDD0046  [12]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0259  AC14 HEK-293T C174(0.85)  LDD1512  [13]
 LDCM0282  AC22 HEK-293T C174(0.79)  LDD1521  [13]
 LDCM0291  AC30 HEK-293T C174(0.83)  LDD1530  [13]
 LDCM0299  AC38 HEK-293T C174(1.04)  LDD1538  [13]
 LDCM0308  AC46 HEK-293T C174(0.92)  LDD1547  [13]
 LDCM0317  AC54 HEK-293T C174(0.96)  LDD1556  [13]
 LDCM0323  AC6 HEK-293T C174(0.85)  LDD1562  [13]
 LDCM0326  AC62 HEK-293T C174(0.89)  LDD1565  [13]
 LDCM0156  Aniline NCI-H1299 12.31  LDD0403  [1]
 LDCM0070  Cisar_cp37 MDA-MB-231 2.56  LDD0120  [4]
 LDCM0367  CL1 HEK-293T C174(1.06)  LDD1571  [13]
 LDCM0368  CL10 HEK-293T C174(1.00)  LDD1572  [13]
 LDCM0369  CL100 HEK-293T C174(0.98)  LDD1573  [13]
 LDCM0370  CL101 HEK-293T C174(1.01)  LDD1574  [13]
 LDCM0373  CL104 HEK-293T C174(1.31)  LDD1577  [13]
 LDCM0374  CL105 HEK-293T C174(0.98)  LDD1578  [13]
 LDCM0377  CL108 HEK-293T C174(1.09)  LDD1581  [13]
 LDCM0378  CL109 HEK-293T C174(1.00)  LDD1582  [13]
 LDCM0382  CL112 HEK-293T C174(0.99)  LDD1586  [13]
 LDCM0383  CL113 HEK-293T C174(0.94)  LDD1587  [13]
 LDCM0386  CL116 HEK-293T C174(1.14)  LDD1590  [13]
 LDCM0387  CL117 HEK-293T C174(0.94)  LDD1591  [13]
 LDCM0391  CL120 HEK-293T C174(1.16)  LDD1595  [13]
 LDCM0392  CL121 HEK-293T C174(1.01)  LDD1596  [13]
 LDCM0395  CL124 HEK-293T C174(0.91)  LDD1599  [13]
 LDCM0396  CL125 HEK-293T C174(1.12)  LDD1600  [13]
 LDCM0399  CL128 HEK-293T C174(0.91)  LDD1603  [13]
 LDCM0400  CL13 HEK-293T C174(1.01)  LDD1604  [13]
 LDCM0403  CL16 HEK-293T C174(1.14)  LDD1607  [13]
 LDCM0410  CL22 HEK-293T C174(0.97)  LDD1614  [13]
 LDCM0413  CL25 HEK-293T C174(1.10)  LDD1617  [13]
 LDCM0416  CL28 HEK-293T C174(1.14)  LDD1620  [13]
 LDCM0423  CL34 HEK-293T C174(1.10)  LDD1627  [13]
 LDCM0426  CL37 HEK-293T C174(1.19)  LDD1630  [13]
 LDCM0429  CL4 HEK-293T C174(0.93)  LDD1633  [13]
 LDCM0430  CL40 HEK-293T C174(0.94)  LDD1634  [13]
 LDCM0436  CL46 HEK-293T C174(1.24)  LDD1640  [13]
 LDCM0439  CL49 HEK-293T C174(1.21)  LDD1643  [13]
 LDCM0443  CL52 HEK-293T C174(1.13)  LDD1646  [13]
 LDCM0449  CL58 HEK-293T C174(0.84)  LDD1652  [13]
 LDCM0453  CL61 HEK-293T C174(1.03)  LDD1656  [13]
 LDCM0456  CL64 HEK-293T C174(1.01)  LDD1659  [13]
 LDCM0463  CL70 HEK-293T C174(1.33)  LDD1666  [13]
 LDCM0466  CL73 HEK-293T C174(0.99)  LDD1669  [13]
 LDCM0469  CL76 HEK-293T C174(1.45)  LDD1672  [13]
 LDCM0476  CL82 HEK-293T C174(0.98)  LDD1679  [13]
 LDCM0479  CL85 HEK-293T C174(1.17)  LDD1682  [13]
 LDCM0482  CL88 HEK-293T C174(0.84)  LDD1685  [13]
 LDCM0489  CL94 HEK-293T C174(0.92)  LDD1692  [13]
 LDCM0492  CL97 HEK-293T C174(1.08)  LDD1695  [13]
 LDCM0616  Fragment61 Jurkat _(20.00)  LDD1489  [5]
 LDCM0615  Fragment63-R Jurkat _(8.63)  LDD1487  [5]
 LDCM0617  Fragment63-S Jurkat _(5.96)  LDD1490  [5]
 LDCM0569  Fragment7 Jurkat _(5.34)  LDD1485  [5]
 LDCM0022  KB02 42-MG-BA C183(2.58)  LDD2244  [3]
 LDCM0023  KB03 769-P C183(2.57)  LDD2663  [3]
 LDCM0024  KB05 G361 C183(1.57)  LDD3311  [3]
 LDCM0014  Panhematin K562 3.26  LDD0063  [6]
 LDCM0131  RA190 MM1.R 4.71  LDD0299  [7]
 LDCM0016  Ranjitkar_cp1 MDA-MB-231 3.33  LDD0123  [4]

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
4 Appendage and Scaffold Diverse Fully Functionalized Small-Molecule Probes via a Minimalist Terminal Alkyne-Aliphatic Diazirine Isocyanide. J Org Chem. 2018 Sep 21;83(18):11245-11253. doi: 10.1021/acs.joc.8b01831. Epub 2018 Aug 31.
5 Proteome-wide covalent ligand discovery in native biological systems. Nature. 2016 Jun 23;534(7608):570-4. doi: 10.1038/nature18002. Epub 2016 Jun 15.
6 A Chemical Proteomic Map of Heme-Protein Interactions. J Am Chem Soc. 2022 Aug 24;144(33):15013-15019. doi: 10.1021/jacs.2c06104. Epub 2022 Aug 12.
Mass spectrometry data entry: PXD034651
7 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.
8 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
9 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
10 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
11 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
12 Mapping Protein Targets of Bioactive Small Molecules Using Lipid-Based Chemical Proteomics. ACS Chem Biol. 2017 Oct 20;12(10):2671-2681. doi: 10.1021/acschembio.7b00581. Epub 2017 Sep 20.
Mass spectrometry data entry: PXD007570
13 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402