General Information of Target

Target ID LDTP10253
Target Name NAD-dependent protein deacetylase sirtuin-1 (SIRT1)
Gene Name SIRT1
Gene ID 23411
Synonyms
SIR2L1; NAD-dependent protein deacetylase sirtuin-1; hSIRT1; EC 2.3.1.286; NAD-dependent protein deacylase sirtuin-1; EC 2.3.1.-; Regulatory protein SIR2 homolog 1; SIR2-like protein 1; hSIR2) [Cleaved into: SirtT1 75 kDa fragment; 75SirT1)]
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQ
LLVSTGLPALDQLLGGGLAVGTVLLIEEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKE
DPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRF
GHYYDASKRMPQELIEASNWHGFFLPEKISSTLKVEPCSLTPGYTKLLQFIQNIIYEEGF
DGSNPQKKQRNILRIGIQNLGSPLWGDDICCAENGGNSHSLTKFLYVLRGLLRTSLSACI
ITMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIRQIPRLNNLI
CDESDVKDLAFKLKRKLFTIERLHLPPDLSDTVSRSSKMDLAESAKRLGPGCGMMAGGKK
HLDF
Target Type
Clinical trial
Target Bioclass
Enzyme
Family
Sirtuin family, Class I subfamily
Subcellular location
Cytoplasm; Nucleus, PML body
Function
NAD-dependent protein deacetylase that links transcriptional regulation directly to intracellular energetics and participates in the coordination of several separated cellular functions such as cell cycle, response to DNA damage, metabolism, apoptosis and autophagy. Can modulate chromatin function through deacetylation of histones and can promote alterations in the methylation of histones and DNA, leading to transcriptional repression. Deacetylates a broad range of transcription factors and coregulators, thereby regulating target gene expression positively and negatively. Serves as a sensor of the cytosolic ratio of NAD(+)/NADH which is altered by glucose deprivation and metabolic changes associated with caloric restriction. Is essential in skeletal muscle cell differentiation and in response to low nutrients mediates the inhibitory effect on skeletal myoblast differentiation which also involves 5'-AMP-activated protein kinase (AMPK) and nicotinamide phosphoribosyltransferase (NAMPT). Component of the eNoSC (energy-dependent nucleolar silencing) complex, a complex that mediates silencing of rDNA in response to intracellular energy status and acts by recruiting histone-modifying enzymes. The eNoSC complex is able to sense the energy status of cell: upon glucose starvation, elevation of NAD(+)/NADP(+) ratio activates SIRT1, leading to histone H3 deacetylation followed by dimethylation of H3 at 'Lys-9' (H3K9me2) by SUV39H1 and the formation of silent chromatin in the rDNA locus. Deacetylates 'Lys-266' of SUV39H1, leading to its activation. Inhibits skeletal muscle differentiation by deacetylating PCAF and MYOD1. Deacetylates H2A and 'Lys-26' of H1-4. Deacetylates 'Lys-16' of histone H4 (in vitro). Involved in NR0B2/SHP corepression function through chromatin remodeling: Recruited to LRH1 target gene promoters by NR0B2/SHP thereby stimulating histone H3 and H4 deacetylation leading to transcriptional repression. Proposed to contribute to genomic integrity via positive regulation of telomere length; however, reports on localization to pericentromeric heterochromatin are conflicting. Proposed to play a role in constitutive heterochromatin (CH) formation and/or maintenance through regulation of the available pool of nuclear SUV39H1. Upon oxidative/metabolic stress decreases SUV39H1 degradation by inhibiting SUV39H1 polyubiquitination by MDM2. This increase in SUV39H1 levels enhances SUV39H1 turnover in CH, which in turn seems to accelerate renewal of the heterochromatin which correlates with greater genomic integrity during stress response. Deacetylates 'Lys-382' of p53/TP53 and impairs its ability to induce transcription-dependent proapoptotic program and modulate cell senescence. Deacetylates TAF1B and thereby represses rDNA transcription by the RNA polymerase I. Deacetylates MYC, promotes the association of MYC with MAX and decreases MYC stability leading to compromised transformational capability. Deacetylates FOXO3 in response to oxidative stress thereby increasing its ability to induce cell cycle arrest and resistance to oxidative stress but inhibiting FOXO3-mediated induction of apoptosis transcriptional activity; also leading to FOXO3 ubiquitination and protesomal degradation. Appears to have a similar effect on MLLT7/FOXO4 in regulation of transcriptional activity and apoptosis. Deacetylates DNMT1; thereby impairs DNMT1 methyltransferase-independent transcription repressor activity, modulates DNMT1 cell cycle regulatory function and DNMT1-mediated gene silencing. Deacetylates RELA/NF-kappa-B p65 thereby inhibiting its transactivating potential and augments apoptosis in response to TNF-alpha. Deacetylates HIF1A, KAT5/TIP60, RB1 and HIC1. Deacetylates FOXO1 resulting in its nuclear retention and enhancement of its transcriptional activity leading to increased gluconeogenesis in liver. Inhibits E2F1 transcriptional activity and apoptotic function, possibly by deacetylation. Involved in HES1- and HEY2-mediated transcriptional repression. In cooperation with MYCN seems to be involved in transcriptional repression of DUSP6/MAPK3 leading to MYCN stabilization by phosphorylation at 'Ser-62'. Deacetylates MEF2D. Required for antagonist-mediated transcription suppression of AR-dependent genes which may be linked to local deacetylation of histone H3. Represses HNF1A-mediated transcription. Required for the repression of ESRRG by CREBZF. Deacetylates NR1H3 and NR1H2 and deacetylation of NR1H3 at 'Lys-434' positively regulates transcription of NR1H3:RXR target genes, promotes NR1H3 proteasomal degradation and results in cholesterol efflux; a promoter clearing mechanism after reach round of transcription is proposed. Involved in lipid metabolism: deacetylates LPIN1, thereby inhibiting diacylglycerol synthesis. Implicated in regulation of adipogenesis and fat mobilization in white adipocytes by repression of PPARG which probably involves association with NCOR1 and SMRT/NCOR2. Deacetylates p300/EP300 and PRMT1. Deacetylates ACSS2 leading to its activation, and HMGCS1 deacetylation. Involved in liver and muscle metabolism. Through deacetylation and activation of PPARGC1A is required to activate fatty acid oxidation in skeletal muscle under low-glucose conditions and is involved in glucose homeostasis. Involved in regulation of PPARA and fatty acid beta-oxidation in liver. Involved in positive regulation of insulin secretion in pancreatic beta cells in response to glucose; the function seems to imply transcriptional repression of UCP2. Proposed to deacetylate IRS2 thereby facilitating its insulin-induced tyrosine phosphorylation. Deacetylates SREBF1 isoform SREBP-1C thereby decreasing its stability and transactivation in lipogenic gene expression. Involved in DNA damage response by repressing genes which are involved in DNA repair, such as XPC and TP73, deacetylating XRCC6/Ku70, and facilitating recruitment of additional factors to sites of damaged DNA, such as SIRT1-deacetylated NBN can recruit ATM to initiate DNA repair and SIRT1-deacetylated XPA interacts with RPA2 . Also involved in DNA repair of DNA double-strand breaks by homologous recombination and specifically single-strand annealing independently of XRCC6/Ku70 and NBN. Promotes DNA double-strand breaks by mediating deacetylation of SIRT6. Transcriptional suppression of XPC probably involves an E2F4:RBL2 suppressor complex and protein kinase B (AKT) signaling. Transcriptional suppression of TP73 probably involves E2F4 and PCAF. Deacetylates WRN thereby regulating its helicase and exonuclease activities and regulates WRN nuclear translocation in response to DNA damage. Deacetylates APEX1 at 'Lys-6' and 'Lys-7' and stimulates cellular AP endonuclease activity by promoting the association of APEX1 to XRCC1. Catalyzes deacetylation of ERCC4/XPF, thereby impairing interaction with ERCC1 and nucleotide excision repair (NER). Increases p53/TP53-mediated transcription-independent apoptosis by blocking nuclear translocation of cytoplasmic p53/TP53 and probably redirecting it to mitochondria. Deacetylates XRCC6/Ku70 at 'Lys-539' and 'Lys-542' causing it to sequester BAX away from mitochondria thereby inhibiting stress-induced apoptosis. Is involved in autophagy, presumably by deacetylating ATG5, ATG7 and MAP1LC3B/ATG8. Deacetylates AKT1 which leads to enhanced binding of AKT1 and PDK1 to PIP3 and promotes their activation. Proposed to play role in regulation of STK11/LBK1-dependent AMPK signaling pathways implicated in cellular senescence which seems to involve the regulation of the acetylation status of STK11/LBK1. Can deacetylate STK11/LBK1 and thereby increase its activity, cytoplasmic localization and association with STRAD; however, the relevance of such activity in normal cells is unclear. In endothelial cells is shown to inhibit STK11/LBK1 activity and to promote its degradation. Deacetylates SMAD7 at 'Lys-64' and 'Lys-70' thereby promoting its degradation. Deacetylates CIITA and augments its MHC class II transactivation and contributes to its stability. Deacetylates MECOM/EVI1. Deacetylates PML at 'Lys-487' and this deacetylation promotes PML control of PER2 nuclear localization. During the neurogenic transition, represses selective NOTCH1-target genes through histone deacetylation in a BCL6-dependent manner and leading to neuronal differentiation. Regulates the circadian expression of several core clock genes, including BMAL1, RORC, PER2 and CRY1 and plays a critical role in maintaining a controlled rhythmicity in histone acetylation, thereby contributing to circadian chromatin remodeling. Deacetylates BMAL1 and histones at the circadian gene promoters in order to facilitate repression by inhibitory components of the circadian oscillator. Deacetylates PER2, facilitating its ubiquitination and degradation by the proteasome. Protects cardiomyocytes against palmitate-induced apoptosis. Deacetylates XBP1 isoform 2; deacetylation decreases protein stability of XBP1 isoform 2 and inhibits its transcriptional activity. Deacetylates PCK1 and directs its activity toward phosphoenolpyruvate production promoting gluconeogenesis. Involved in the CCAR2-mediated regulation of PCK1 and NR1D1. Deacetylates CTNB1 at 'Lys-49'. In POMC (pro-opiomelanocortin) neurons, required for leptin-induced activation of PI3K signaling. In addition to protein deacetylase activity, also acts as a protein-lysine deacylase by mediating protein depropionylation and decrotonylation. Mediates depropionylation of Osterix (SP7). Catalyzes decrotonylation of histones; it however does not represent a major histone decrotonylase. Deacetylates SOX9; promoting SOX9 nuclear localization and transactivation activity. Involved in the regulation of centrosome duplication. Deacetylates CENATAC in G1 phase, allowing for SASS6 accumulation on the centrosome and subsequent procentriole assembly. Deacetylates NDC80/HEC1.; [Isoform 2]: Deacetylates 'Lys-382' of p53/TP53, however with lower activity than isoform 1. In combination, the two isoforms exert an additive effect. Isoform 2 regulates p53/TP53 expression and cellular stress response and is in turn repressed by p53/TP53 presenting a SIRT1 isoform-dependent auto-regulatory loop.; [SirtT1 75 kDa fragment]: Catalytically inactive 75SirT1 may be involved in regulation of apoptosis. May be involved in protecting chondrocytes from apoptotic death by associating with cytochrome C and interfering with apoptosome assembly.; (Microbial infection) In case of HIV-1 infection, interacts with and deacetylates the viral Tat protein. The viral Tat protein inhibits SIRT1 deacetylation activity toward RELA/NF-kappa-B p65, thereby potentiates its transcriptional activity and SIRT1 is proposed to contribute to T-cell hyperactivation during infection.
TTD ID
T14731
Uniprot ID
Q96EB6
DrugMap ID
TTUF2HO
Ensemble ID
ENST00000212015.11
HGNC ID
HGNC:14929
ChEMBL ID
CHEMBL4506

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
AU565 SNV: p.T177I DBIA    Probe Info 
IM95 Deletion: p.R237EfsTer11 DBIA    Probe Info 
JHH6 SNV: p.S27T DBIA    Probe Info 
LN18 SNV: p.P393R .
MOLT4 Deletion: p.F414LfsTer13 IA-alkyne    Probe Info 
NCIH146 SNV: p.Q632H DBIA    Probe Info 
NUGC3 SNV: p.G52V .
PF382 SNV: p.Y650C DBIA    Probe Info 
REH SNV: p.R649H DBIA    Probe Info 
SNGM SNV: p.R199Q DBIA    Probe Info 
SUPT1 Deletion: p.F414LfsTer13 DBIA    Probe Info 
SW620 SNV: p.V383I DBIA    Probe Info 
TF1 SNV: p.G480E DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 20 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info 
13.52  LDD0402  [1]
BTD
 Probe Info 
C501(0.51)  LDD1700  [2]
DBIA
 Probe Info 
C67(1.10)  LDD0078  [3]
ATP probe
 Probe Info 
N.A.  LDD0199  [4]
4-Iodoacetamidophenylacetylene
 Probe Info 
C398(0.00); C326(0.00); C574(0.00); C67(0.00)  LDD0038  [5]
IA-alkyne
 Probe Info 
N.A.  LDD0032  [6]
IPIAA_L
 Probe Info 
N.A.  LDD0031  [7]
Lodoacetamide azide
 Probe Info 
C398(0.00); C326(0.00); C380(0.00); C67(0.00)  LDD0037  [5]
NAIA_4
 Probe Info 
C67(0.00); C398(0.00)  LDD2226  [8]
WYneN
 Probe Info 
N.A.  LDD0021  [9]
WYneO
 Probe Info 
N.A.  LDD0022  [9]
Compound 10
 Probe Info 
N.A.  LDD2216  [10]
Compound 11
 Probe Info 
N.A.  LDD2213  [10]
IPM
 Probe Info 
N.A.  LDD0005  [9]
TFBX
 Probe Info 
C253(0.00); C380(0.00)  LDD0148  [11]
VSF
 Probe Info 
C574(0.00); C380(0.00)  LDD0007  [9]
Phosphinate-6
 Probe Info 
C574(0.00); C380(0.00); C67(0.00)  LDD0018  [12]
Methacrolein
 Probe Info 
N.A.  LDD0218  [13]
AOyne
 Probe Info 
14.10  LDD0443  [14]
NAIA_5
 Probe Info 
C398(0.00); C574(0.00)  LDD2223  [8]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C574(1.37)  LDD2117  [2]
 LDCM0214  AC1 HCT 116 C380(1.03); C501(1.68); C502(1.33); C574(0.62)  LDD0531  [3]
 LDCM0215  AC10 HCT 116 C380(0.86); C501(1.05); C502(0.99); C574(1.12)  LDD0532  [3]
 LDCM0216  AC100 HCT 116 C380(1.50); C501(0.67); C502(0.67); C574(0.76)  LDD0533  [3]
 LDCM0217  AC101 HCT 116 C380(1.12); C501(0.63); C502(0.63); C574(0.88)  LDD0534  [3]
 LDCM0218  AC102 HCT 116 C380(0.85); C501(0.76); C502(0.76); C574(0.97)  LDD0535  [3]
 LDCM0219  AC103 HCT 116 C380(1.16); C501(0.67); C502(0.67); C574(1.12)  LDD0536  [3]
 LDCM0220  AC104 HCT 116 C380(0.99); C501(0.81); C502(0.81); C574(1.07)  LDD0537  [3]
 LDCM0221  AC105 HCT 116 C380(1.25); C501(0.61); C502(0.61); C574(1.03)  LDD0538  [3]
 LDCM0222  AC106 HCT 116 C380(1.35); C501(0.65); C502(0.65); C574(0.96)  LDD0539  [3]
 LDCM0223  AC107 HCT 116 C380(1.16); C501(0.64); C502(0.64); C574(0.65)  LDD0540  [3]
 LDCM0224  AC108 HCT 116 C380(1.49); C501(0.69); C502(0.69); C574(1.15)  LDD0541  [3]
 LDCM0225  AC109 HCT 116 C380(1.21); C501(0.91); C502(0.91); C574(1.36)  LDD0542  [3]
 LDCM0226  AC11 HCT 116 C380(0.94); C501(1.12); C502(0.94); C574(1.28)  LDD0543  [3]
 LDCM0227  AC110 HCT 116 C380(1.43); C501(0.67); C502(0.67); C574(1.27)  LDD0544  [3]
 LDCM0228  AC111 HCT 116 C380(1.12); C501(0.69); C502(0.69); C574(1.19)  LDD0545  [3]
 LDCM0229  AC112 HCT 116 C380(1.31); C501(0.75); C502(0.75); C574(1.05)  LDD0546  [3]
 LDCM0230  AC113 HCT 116 C380(1.07); C501(1.03); C502(1.03); C574(0.86)  LDD0547  [3]
 LDCM0231  AC114 HCT 116 C380(0.88); C501(0.96); C502(1.17); C574(0.89)  LDD0548  [3]
 LDCM0232  AC115 HCT 116 C380(0.89); C501(1.06); C502(1.11); C574(0.90)  LDD0549  [3]
 LDCM0233  AC116 HCT 116 C380(0.98); C501(1.04); C502(1.17); C574(0.93)  LDD0550  [3]
 LDCM0234  AC117 HCT 116 C380(1.11); C501(1.36); C502(1.37); C574(0.86)  LDD0551  [3]
 LDCM0235  AC118 HCT 116 C380(0.91); C501(1.33); C502(1.15); C574(0.78)  LDD0552  [3]
 LDCM0236  AC119 HCT 116 C380(1.31); C501(1.07); C502(1.10); C574(0.78)  LDD0553  [3]
 LDCM0237  AC12 HCT 116 C380(1.01); C501(1.17); C502(1.05); C574(1.28)  LDD0554  [3]
 LDCM0238  AC120 HCT 116 C380(0.98); C501(0.97); C502(1.06); C574(0.94)  LDD0555  [3]
 LDCM0239  AC121 HCT 116 C380(0.81); C501(1.34); C502(1.34); C574(0.74)  LDD0556  [3]
 LDCM0240  AC122 HCT 116 C380(1.05); C501(0.94); C502(1.08); C574(0.67)  LDD0557  [3]
 LDCM0241  AC123 HCT 116 C380(0.83); C501(0.99); C502(1.29); C574(0.63)  LDD0558  [3]
 LDCM0242  AC124 HCT 116 C380(0.93); C501(1.24); C502(1.17); C574(0.75)  LDD0559  [3]
 LDCM0243  AC125 HCT 116 C380(0.86); C501(0.90); C502(1.02); C574(0.53)  LDD0560  [3]
 LDCM0244  AC126 HCT 116 C380(0.97); C501(0.91); C502(0.94); C574(0.70)  LDD0561  [3]
 LDCM0245  AC127 HCT 116 C380(1.02); C501(1.28); C502(1.13); C574(0.44)  LDD0562  [3]
 LDCM0246  AC128 HCT 116 C380(0.77); C501(1.04); C502(1.04); C574(0.59)  LDD0563  [3]
 LDCM0247  AC129 HCT 116 C380(1.06); C501(0.92); C502(0.92); C574(0.69)  LDD0564  [3]
 LDCM0249  AC130 HCT 116 C380(1.97); C501(1.03); C502(1.03); C574(0.74)  LDD0566  [3]
 LDCM0250  AC131 HCT 116 C380(0.97); C501(0.91); C502(0.91); C574(0.91)  LDD0567  [3]
 LDCM0251  AC132 HCT 116 C380(1.17); C501(1.30); C502(1.30); C574(0.64)  LDD0568  [3]
 LDCM0252  AC133 HCT 116 C380(1.12); C501(1.00); C502(1.00); C574(0.69)  LDD0569  [3]
 LDCM0253  AC134 HCT 116 C380(1.17); C501(0.99); C502(0.99); C574(0.74)  LDD0570  [3]
 LDCM0254  AC135 HCT 116 C380(1.18); C501(0.95); C502(0.95); C574(0.56)  LDD0571  [3]
 LDCM0255  AC136 HCT 116 C380(1.25); C501(1.09); C502(1.09); C574(0.64)  LDD0572  [3]
 LDCM0256  AC137 HCT 116 C380(1.23); C501(1.17); C502(1.17); C574(0.62)  LDD0573  [3]
 LDCM0257  AC138 HCT 116 C380(1.35); C501(1.17); C502(1.17); C574(0.85)  LDD0574  [3]
 LDCM0258  AC139 HCT 116 C380(1.56); C501(1.00); C502(1.00); C574(0.74)  LDD0575  [3]
 LDCM0259  AC14 HCT 116 C380(0.82); C501(0.92); C502(0.89); C574(1.70)  LDD0576  [3]
 LDCM0260  AC140 HCT 116 C380(1.59); C501(1.12); C502(1.12); C574(0.86)  LDD0577  [3]
 LDCM0261  AC141 HCT 116 C380(1.57); C501(1.09); C502(1.09); C574(0.89)  LDD0578  [3]
 LDCM0262  AC142 HCT 116 C380(1.70); C501(1.27); C502(1.27); C574(0.76)  LDD0579  [3]
 LDCM0263  AC143 HCT 116 C501(0.90); C502(0.90); C574(1.27); C380(1.70)  LDD0580  [3]
 LDCM0264  AC144 HCT 116 C380(0.72); C502(0.86); C501(0.91); C574(1.76)  LDD0581  [3]
 LDCM0265  AC145 HCT 116 C380(0.79); C501(0.99); C502(1.03); C574(1.14)  LDD0582  [3]
 LDCM0266  AC146 HCT 116 C380(0.85); C501(0.91); C502(0.93); C574(1.49)  LDD0583  [3]
 LDCM0267  AC147 HCT 116 C501(0.95); C502(0.97); C380(1.07); C574(1.48)  LDD0584  [3]
 LDCM0268  AC148 HCT 116 C380(0.93); C501(0.93); C502(1.00); C574(1.68)  LDD0585  [3]
 LDCM0269  AC149 HCT 116 C380(0.80); C501(0.85); C502(0.92); C574(1.57)  LDD0586  [3]
 LDCM0270  AC15 HCT 116 C380(0.85); C501(0.96); C502(0.98); C574(1.46)  LDD0587  [3]
 LDCM0271  AC150 HCT 116 C502(1.00); C574(1.01); C501(1.02); C380(1.03)  LDD0588  [3]
 LDCM0272  AC151 HCT 116 C502(0.84); C501(0.86); C380(1.00); C574(1.14)  LDD0589  [3]
 LDCM0273  AC152 HCT 116 C502(0.89); C501(0.90); C380(0.95); C574(1.21)  LDD0590  [3]
 LDCM0274  AC153 HCT 116 C380(0.83); C501(0.84); C502(0.85); C574(1.88)  LDD0591  [3]
 LDCM0621  AC154 HCT 116 C380(0.77); C501(0.97); C502(1.02); C574(1.34)  LDD2158  [3]
 LDCM0622  AC155 HCT 116 C380(0.70); C501(0.96); C502(0.97); C574(1.16)  LDD2159  [3]
 LDCM0623  AC156 HCT 116 C380(0.86); C501(0.96); C502(0.98); C574(1.28)  LDD2160  [3]
 LDCM0624  AC157 HCT 116 C380(0.84); C501(1.04); C502(1.04); C574(1.03)  LDD2161  [3]
 LDCM0276  AC17 HCT 116 C574(0.91); C67(1.12); C501(1.13); C502(1.13)  LDD0593  [3]
 LDCM0277  AC18 HCT 116 C380(0.90); C501(0.93); C502(0.93); C67(1.27)  LDD0594  [3]
 LDCM0278  AC19 HCT 116 C380(0.83); C574(0.88); C501(1.01); C502(1.01)  LDD0595  [3]
 LDCM0279  AC2 HCT 116 C67(0.87); C574(0.90); C380(1.00); C501(1.16)  LDD0596  [3]
 LDCM0280  AC20 HCT 116 C380(0.86); C574(0.91); C501(1.12); C502(1.12)  LDD0597  [3]
 LDCM0281  AC21 HCT 116 C380(0.91); C501(1.02); C502(1.02); C574(1.10)  LDD0598  [3]
 LDCM0282  AC22 HCT 116 C574(0.88); C501(0.97); C502(0.97); C67(0.98)  LDD0599  [3]
 LDCM0283  AC23 HCT 116 C574(0.79); C501(0.99); C502(0.99); C380(1.03)  LDD0600  [3]
 LDCM0284  AC24 HCT 116 C574(0.81); C380(1.01); C501(1.26); C502(1.26)  LDD0601  [3]
 LDCM0285  AC25 HCT 116 C67(0.85); C501(0.87); C502(0.87); C574(1.00)  LDD0602  [3]
 LDCM0286  AC26 HCT 116 C501(0.80); C502(0.80); C67(0.86); C574(1.11)  LDD0603  [3]
 LDCM0287  AC27 HCT 116 C67(0.86); C501(0.93); C502(0.93); C574(1.14)  LDD0604  [3]
 LDCM0288  AC28 HCT 116 C67(0.79); C501(1.00); C502(1.00); C574(1.07)  LDD0605  [3]
 LDCM0289  AC29 HCT 116 C67(0.81); C501(0.85); C502(0.85); C574(1.14)  LDD0606  [3]
 LDCM0290  AC3 HCT 116 C67(0.74); C574(0.78); C380(1.20); C502(1.24)  LDD0607  [3]
 LDCM0291  AC30 HCT 116 C501(0.88); C502(0.88); C67(1.01); C574(1.25)  LDD0608  [3]
 LDCM0292  AC31 HCT 116 C501(0.79); C502(0.79); C67(0.87); C574(1.11)  LDD0609  [3]
 LDCM0293  AC32 HCT 116 C501(0.88); C502(0.88); C67(0.99); C574(1.42)  LDD0610  [3]
 LDCM0294  AC33 HCT 116 C501(0.84); C502(0.84); C67(0.92); C574(1.17)  LDD0611  [3]
 LDCM0295  AC34 HCT 116 C501(0.87); C502(0.87); C67(1.05); C574(1.46)  LDD0612  [3]
 LDCM0296  AC35 HCT 116 C67(0.92); C380(0.97); C574(1.04); C501(1.10)  LDD0613  [3]
 LDCM0297  AC36 HCT 116 C67(0.85); C380(0.93); C501(1.03); C502(1.03)  LDD0614  [3]
 LDCM0298  AC37 HCT 116 C574(0.87); C67(0.89); C380(0.93); C501(1.16)  LDD0615  [3]
 LDCM0299  AC38 HCT 116 C67(0.95); C380(0.97); C574(1.00); C501(1.01)  LDD0616  [3]
 LDCM0300  AC39 HCT 116 C67(0.65); C574(1.03); C501(1.14); C502(1.14)  LDD0617  [3]
 LDCM0301  AC4 HCT 116 C67(0.76); C574(1.04); C380(1.14); C502(1.17)  LDD0618  [3]
 LDCM0302  AC40 HCT 116 C380(0.75); C67(0.85); C574(0.92); C501(1.03)  LDD0619  [3]
 LDCM0303  AC41 HCT 116 C67(0.76); C574(0.94); C501(0.96); C502(0.96)  LDD0620  [3]
 LDCM0304  AC42 HCT 116 C67(0.84); C380(0.96); C501(1.01); C502(1.01)  LDD0621  [3]
 LDCM0305  AC43 HCT 116 C67(0.75); C574(1.01); C501(1.02); C502(1.02)  LDD0622  [3]
 LDCM0306  AC44 HCT 116 C67(0.74); C380(0.81); C574(0.95); C501(1.12)  LDD0623  [3]
 LDCM0307  AC45 HCT 116 C380(0.87); C67(0.87); C574(1.04); C501(1.17)  LDD0624  [3]
 LDCM0308  AC46 HCT 116 C67(0.90); C501(0.92); C502(0.92); C380(1.53)  LDD0625  [3]
 LDCM0309  AC47 HCT 116 C67(0.81); C574(0.97); C501(1.00); C502(1.00)  LDD0626  [3]
 LDCM0310  AC48 HCT 116 C67(0.78); C501(0.91); C502(0.91); C380(1.14)  LDD0627  [3]
 LDCM0311  AC49 HCT 116 C574(0.86); C501(0.88); C502(0.88); C67(1.10)  LDD0628  [3]
 LDCM0312  AC5 HCT 116 C67(0.67); C574(0.91); C380(1.17); C502(1.30)  LDD0629  [3]
 LDCM0313  AC50 HCT 116 C574(0.90); C501(0.91); C502(0.91); C67(1.00)  LDD0630  [3]
 LDCM0314  AC51 HCT 116 C501(0.93); C502(0.93); C67(0.95); C574(0.96)  LDD0631  [3]
 LDCM0315  AC52 HCT 116 C574(0.88); C67(0.90); C501(1.00); C502(1.00)  LDD0632  [3]
 LDCM0316  AC53 HCT 116 C574(0.58); C67(0.94); C501(0.99); C502(0.99)  LDD0633  [3]
 LDCM0317  AC54 HCT 116 C67(0.85); C574(0.99); C501(1.00); C502(1.00)  LDD0634  [3]
 LDCM0318  AC55 HCT 116 C574(0.54); C67(0.80); C501(0.93); C502(0.93)  LDD0635  [3]
 LDCM0319  AC56 HCT 116 C574(0.67); C67(1.00); C501(1.00); C502(1.00)  LDD0636  [3]
 LDCM0320  AC57 HCT 116 C502(0.92); C501(1.00); C67(1.03); C380(1.08)  LDD0637  [3]
 LDCM0321  AC58 HCT 116 C502(0.88); C380(0.91); C501(0.98); C67(1.35)  LDD0638  [3]
 LDCM0322  AC59 HCT 116 C502(0.87); C380(1.00); C501(1.02); C67(1.12)  LDD0639  [3]
 LDCM0323  AC6 HCT 116 C501(0.96); C67(0.97); C380(0.98); C502(1.04)  LDD0640  [3]
 LDCM0324  AC60 HCT 116 C380(0.94); C502(1.07); C67(1.19); C501(1.34)  LDD0641  [3]
 LDCM0325  AC61 HCT 116 C502(0.95); C67(0.98); C501(0.99); C574(1.37)  LDD0642  [3]
 LDCM0326  AC62 HCT 116 C67(0.95); C502(1.04); C501(1.22); C574(1.49)  LDD0643  [3]
 LDCM0327  AC63 HCT 116 C502(1.08); C380(1.13); C67(1.17); C574(1.18)  LDD0644  [3]
 LDCM0328  AC64 HCT 116 C380(1.08); C502(1.20); C501(1.25); C67(1.28)  LDD0645  [3]
 LDCM0329  AC65 HCT 116 C502(0.91); C574(0.92); C501(1.00); C67(1.15)  LDD0646  [3]
 LDCM0330  AC66 HCT 116 C502(0.82); C574(0.88); C501(0.94); C67(1.29)  LDD0647  [3]
 LDCM0331  AC67 HCT 116 C502(0.92); C501(1.16); C67(1.23); C574(1.26)  LDD0648  [3]
 LDCM0332  AC68 HCT 116 C380(0.77); C67(1.07); C501(1.12); C502(1.12)  LDD0649  [3]
 LDCM0333  AC69 HCT 116 C380(0.79); C501(0.99); C502(0.99); C67(1.07)  LDD0650  [3]
 LDCM0334  AC7 HCT 116 C380(0.73); C501(0.97); C502(0.98); C67(1.03)  LDD0651  [3]
 LDCM0335  AC70 HCT 116 C67(0.93); C501(0.99); C502(0.99); C380(1.23)  LDD0652  [3]
 LDCM0336  AC71 HCT 116 C380(0.88); C67(0.95); C501(1.01); C502(1.01)  LDD0653  [3]
 LDCM0337  AC72 HCT 116 C67(0.89); C501(1.01); C502(1.01); C380(1.11)  LDD0654  [3]
 LDCM0338  AC73 HCT 116 C501(0.91); C502(0.91); C67(0.99); C380(1.25)  LDD0655  [3]
 LDCM0339  AC74 HCT 116 C380(0.92); C501(0.93); C502(0.93); C67(0.98)  LDD0656  [3]
 LDCM0340  AC75 HCT 116 C501(0.89); C502(0.89); C67(1.03); C380(1.11)  LDD0657  [3]
 LDCM0341  AC76 HCT 116 C67(0.94); C380(1.06); C501(1.11); C502(1.11)  LDD0658  [3]
 LDCM0342  AC77 HCT 116 C380(0.90); C501(1.11); C502(1.11); C67(1.14)  LDD0659  [3]
 LDCM0343  AC78 HCT 116 C380(0.92); C67(0.98); C574(0.99); C501(1.04)  LDD0660  [3]
 LDCM0344  AC79 HCT 116 C67(0.92); C501(0.99); C502(0.99); C380(1.05)  LDD0661  [3]
 LDCM0345  AC8 HCT 116 C501(0.92); C502(0.95); C380(0.96); C67(1.29)  LDD0662  [3]
 LDCM0346  AC80 HCT 116 C67(0.88); C380(0.94); C501(1.11); C502(1.11)  LDD0663  [3]
 LDCM0347  AC81 HCT 116 C67(0.90); C380(0.93); C501(1.22); C502(1.22)  LDD0664  [3]
 LDCM0348  AC82 HCT 116 C67(0.94); C501(1.05); C502(1.05); C380(1.08)  LDD0665  [3]
 LDCM0349  AC83 HCT 116 C502(0.81); C67(0.89); C501(0.98); C380(1.09)  LDD0666  [3]
 LDCM0350  AC84 HCT 116 C502(0.82); C380(1.00); C501(1.03); C67(1.08)  LDD0667  [3]
 LDCM0351  AC85 HCT 116 C67(0.85); C502(0.86); C501(1.09); C380(1.24)  LDD0668  [3]
 LDCM0352  AC86 HCT 116 C67(0.84); C502(0.92); C501(1.01); C380(1.20)  LDD0669  [3]
 LDCM0353  AC87 HCT 116 C67(0.79); C502(0.89); C501(0.97); C380(1.19)  LDD0670  [3]
 LDCM0354  AC88 HCT 116 C67(0.85); C501(1.09); C380(1.14); C502(1.16)  LDD0671  [3]
 LDCM0355  AC89 HCT 116 C67(0.75); C502(0.82); C501(0.96); C380(1.04)  LDD0672  [3]
 LDCM0357  AC90 HCT 116 C67(0.67); C502(0.90); C501(0.93); C574(0.97)  LDD0674  [3]
 LDCM0358  AC91 HCT 116 C67(0.78); C502(1.11); C501(1.22); C380(1.33)  LDD0675  [3]
 LDCM0359  AC92 HCT 116 C67(0.62); C502(0.97); C501(1.06); C380(1.36)  LDD0676  [3]
 LDCM0360  AC93 HCT 116 C502(0.82); C67(0.96); C501(1.02); C380(1.05)  LDD0677  [3]
 LDCM0361  AC94 HCT 116 C67(0.70); C574(1.16); C502(1.30); C380(1.32)  LDD0678  [3]
 LDCM0362  AC95 HCT 116 C67(0.79); C502(1.02); C501(1.06); C574(1.22)  LDD0679  [3]
 LDCM0363  AC96 HCT 116 C67(0.87); C502(1.17); C501(1.32); C380(1.36)  LDD0680  [3]
 LDCM0364  AC97 HCT 116 C67(0.74); C502(0.85); C501(1.01); C380(1.32)  LDD0681  [3]
 LDCM0365  AC98 HCT 116 C501(0.60); C502(0.60); C67(0.85); C574(1.23)  LDD0682  [3]
 LDCM0366  AC99 HCT 116 C501(0.66); C502(0.66); C574(0.88); C67(0.91)  LDD0683  [3]
 LDCM0248  AKOS034007472 HCT 116 C380(1.15); C501(1.04); C502(0.97); C574(0.93)  LDD0565  [3]
 LDCM0356  AKOS034007680 HCT 116 C502(0.88); C380(0.91); C67(0.97); C501(0.98)  LDD0673  [3]
 LDCM0275  AKOS034007705 HCT 116 C501(0.95); C380(0.99); C502(1.04); C574(1.39)  LDD0592  [3]
 LDCM0156  Aniline NCI-H1299 13.22  LDD0403  [1]
 LDCM0020  ARS-1620 HCC44 C67(1.10)  LDD0078  [3]
 LDCM0632  CL-Sc Hep-G2 C574(0.76)  LDD2227  [8]
 LDCM0367  CL1 HCT 116 C574(0.80); C67(0.89); C380(0.91); C502(1.00)  LDD0684  [3]
 LDCM0368  CL10 HCT 116 C574(0.48); C67(0.73); C380(0.84); C502(1.05)  LDD0685  [3]
 LDCM0369  CL100 HCT 116 C574(0.62); C380(0.86); C67(0.87); C502(1.06)  LDD0686  [3]
 LDCM0370  CL101 HCT 116 C380(0.83); C502(1.02); C501(1.05); C574(1.71)  LDD0687  [3]
 LDCM0371  CL102 HCT 116 C380(0.82); C502(0.91); C574(0.95); C501(0.99)  LDD0688  [3]
 LDCM0372  CL103 HCT 116 C380(0.94); C502(1.03); C501(1.15); C574(1.20)  LDD0689  [3]
 LDCM0373  CL104 HCT 116 C380(0.84); C502(0.94); C501(0.96); C574(1.15)  LDD0690  [3]
 LDCM0374  CL105 HCT 116 C380(0.88); C67(0.88); C501(1.18); C502(1.18)  LDD0691  [3]
 LDCM0375  CL106 HCT 116 C380(0.75); C67(1.02); C501(1.16); C502(1.16)  LDD0692  [3]
 LDCM0376  CL107 HCT 116 C380(0.77); C67(0.88); C501(0.93); C502(0.93)  LDD0693  [3]
 LDCM0377  CL108 HCT 116 C67(0.83); C380(0.86); C501(1.17); C502(1.17)  LDD0694  [3]
 LDCM0378  CL109 HCT 116 C67(0.89); C574(0.96); C501(0.99); C502(0.99)  LDD0695  [3]
 LDCM0379  CL11 HCT 116 C574(0.45); C67(0.80); C502(1.03); C380(1.08)  LDD0696  [3]
 LDCM0380  CL110 HCT 116 C67(0.86); C380(0.92); C574(1.06); C501(1.24)  LDD0697  [3]
 LDCM0381  CL111 HCT 116 C380(0.74); C501(0.86); C502(0.86); C67(0.90)  LDD0698  [3]
 LDCM0382  CL112 HCT 116 C501(0.88); C502(0.88); C67(1.00); C574(1.08)  LDD0699  [3]
 LDCM0383  CL113 HCT 116 C501(0.90); C502(0.90); C67(1.03); C574(1.38)  LDD0700  [3]
 LDCM0384  CL114 HCT 116 C501(0.71); C502(0.71); C67(0.83); C574(1.14)  LDD0701  [3]
 LDCM0385  CL115 HCT 116 C501(0.76); C502(0.76); C67(1.00); C574(1.24)  LDD0702  [3]
 LDCM0386  CL116 HCT 116 C501(0.82); C502(0.82); C67(1.08); C574(1.20)  LDD0703  [3]
 LDCM0387  CL117 HCT 116 C67(0.95); C380(0.95); C501(1.08); C502(1.08)  LDD0704  [3]
 LDCM0388  CL118 HCT 116 C67(0.86); C501(1.02); C502(1.02); C574(1.18)  LDD0705  [3]
 LDCM0389  CL119 HCT 116 C67(0.96); C574(1.03); C501(1.07); C502(1.07)  LDD0706  [3]
 LDCM0390  CL12 HCT 116 C574(0.45); C67(0.76); C380(0.96); C502(1.11)  LDD0707  [3]
 LDCM0391  CL120 HCT 116 C67(0.74); C574(0.89); C501(1.06); C502(1.06)  LDD0708  [3]
 LDCM0392  CL121 HCT 116 C501(0.85); C502(0.85); C67(0.95); C380(1.18)  LDD0709  [3]
 LDCM0393  CL122 HCT 116 C501(0.86); C502(0.86); C67(1.02); C574(1.05)  LDD0710  [3]
 LDCM0394  CL123 HCT 116 C67(0.73); C574(0.89); C380(0.99); C501(1.04)  LDD0711  [3]
 LDCM0395  CL124 HCT 116 C574(0.79); C67(0.92); C501(0.95); C502(0.95)  LDD0712  [3]
 LDCM0396  CL125 HCT 116 C574(0.78); C502(0.78); C380(0.98); C67(0.99)  LDD0713  [3]
 LDCM0397  CL126 HCT 116 C502(0.72); C380(0.95); C501(0.98); C574(1.09)  LDD0714  [3]
 LDCM0398  CL127 HCT 116 C502(0.80); C380(1.01); C574(1.05); C501(1.06)  LDD0715  [3]
 LDCM0399  CL128 HCT 116 C502(0.80); C501(0.89); C380(0.94); C67(1.08)  LDD0716  [3]
 LDCM0400  CL13 HCT 116 C574(0.44); C67(0.98); C502(0.98); C501(0.99)  LDD0717  [3]
 LDCM0401  CL14 HCT 116 C574(0.46); C67(0.82); C380(0.94); C502(0.98)  LDD0718  [3]
 LDCM0402  CL15 HCT 116 C574(0.42); C67(0.68); C380(0.86); C501(0.98)  LDD0719  [3]
 LDCM0403  CL16 HCT 116 C501(0.80); C502(0.80); C67(0.94); C380(1.02)  LDD0720  [3]
 LDCM0404  CL17 HCT 116 C574(0.82); C67(0.91); C380(0.97); C501(1.26)  LDD0721  [3]
 LDCM0405  CL18 HCT 116 C67(0.85); C501(0.89); C502(0.89); C574(0.97)  LDD0722  [3]
 LDCM0406  CL19 HCT 116 C380(0.94); C67(0.99); C501(1.04); C502(1.04)  LDD0723  [3]
 LDCM0407  CL2 HCT 116 C67(0.79); C574(0.85); C380(0.92); C502(1.09)  LDD0724  [3]
 LDCM0408  CL20 HCT 116 C380(1.04); C501(1.07); C502(1.07); C67(1.09)  LDD0725  [3]
 LDCM0409  CL21 HCT 116 C67(0.96); C501(1.03); C502(1.03); C380(1.24)  LDD0726  [3]
 LDCM0410  CL22 HCT 116 C501(1.08); C502(1.08); C380(1.13); C67(1.37)  LDD0727  [3]
 LDCM0411  CL23 HCT 116 C67(0.89); C574(0.92); C501(1.16); C502(1.16)  LDD0728  [3]
 LDCM0412  CL24 HCT 116 C380(1.44); C501(1.02); C502(1.02); C574(1.34)  LDD0729  [3]
 LDCM0413  CL25 HCT 116 C380(1.08); C501(0.88); C502(0.88); C574(1.15)  LDD0730  [3]
 LDCM0414  CL26 HCT 116 C380(1.25); C501(0.96); C502(0.96); C574(0.98)  LDD0731  [3]
 LDCM0415  CL27 HCT 116 C380(1.07); C501(0.97); C502(0.97); C574(0.91)  LDD0732  [3]
 LDCM0416  CL28 HCT 116 C380(1.52); C501(0.97); C502(0.97); C574(1.21)  LDD0733  [3]
 LDCM0417  CL29 HCT 116 C380(1.42); C501(1.11); C502(1.11); C574(1.16)  LDD0734  [3]
 LDCM0418  CL3 HCT 116 C380(0.80); C501(1.11); C502(0.98); C574(0.67)  LDD0735  [3]
 LDCM0419  CL30 HCT 116 C380(1.47); C501(1.07); C502(1.07); C574(0.97)  LDD0736  [3]
 LDCM0420  CL31 HCT 116 C380(1.04); C574(0.89); C67(0.89)  LDD0737  [3]
 LDCM0421  CL32 HCT 116 C380(1.14); C501(0.74); C502(0.74); C574(0.92)  LDD0738  [3]
 LDCM0422  CL33 HCT 116 C380(1.01); C501(0.82); C502(0.82); C574(0.86)  LDD0739  [3]
 LDCM0423  CL34 HCT 116 C380(1.11); C501(0.81); C502(0.81); C574(0.79)  LDD0740  [3]
 LDCM0424  CL35 HCT 116 C380(1.31); C501(0.84); C502(0.84); C574(1.06)  LDD0741  [3]
 LDCM0425  CL36 HCT 116 C380(1.06); C501(0.90); C502(0.90); C574(0.90)  LDD0742  [3]
 LDCM0426  CL37 HCT 116 C380(1.12); C501(0.87); C502(0.87); C574(0.79)  LDD0743  [3]
 LDCM0428  CL39 HCT 116 C380(1.14); C501(0.89); C502(0.89); C574(0.67)  LDD0745  [3]
 LDCM0429  CL4 HCT 116 C380(0.86); C501(1.13); C502(1.07); C574(0.84)  LDD0746  [3]
 LDCM0430  CL40 HCT 116 C380(0.99); C501(0.91); C502(0.91); C574(0.56)  LDD0747  [3]
 LDCM0431  CL41 HCT 116 C380(1.10); C501(0.80); C502(0.80); C574(0.54)  LDD0748  [3]
 LDCM0432  CL42 HCT 116 C380(1.11); C501(0.97); C502(0.97); C574(0.67)  LDD0749  [3]
 LDCM0433  CL43 HCT 116 C380(1.07); C501(0.82); C502(0.82); C574(0.52)  LDD0750  [3]
 LDCM0434  CL44 HCT 116 C380(1.22); C501(0.90); C502(0.90); C574(0.56)  LDD0751  [3]
 LDCM0435  CL45 HCT 116 C380(1.29); C501(0.81); C502(0.81); C574(0.60)  LDD0752  [3]
 LDCM0436  CL46 HCT 116 C501(0.92); C502(1.07); C574(0.53); C67(0.89)  LDD0753  [3]
 LDCM0437  CL47 HCT 116 C501(1.15); C502(1.14); C574(0.64); C67(0.95)  LDD0754  [3]
 LDCM0438  CL48 HCT 116 C501(0.85); C502(0.99); C574(0.46); C67(0.92)  LDD0755  [3]
 LDCM0439  CL49 HCT 116 C501(1.05); C502(1.01); C574(0.49); C67(0.92)  LDD0756  [3]
 LDCM0440  CL5 HCT 116 C380(0.95); C501(1.05); C502(0.95); C574(0.55)  LDD0757  [3]
 LDCM0441  CL50 HCT 116 C501(1.07); C502(1.06); C574(0.41); C67(1.06)  LDD0758  [3]
 LDCM0442  CL51 HCT 116 C501(0.97); C502(1.03); C574(0.44); C67(0.91)  LDD0759  [3]
 LDCM0443  CL52 HCT 116 C501(0.93); C502(1.05); C574(0.56); C67(0.99)  LDD0760  [3]
 LDCM0444  CL53 HCT 116 C501(1.00); C502(1.09); C574(0.82); C67(1.48)  LDD0761  [3]
 LDCM0445  CL54 HCT 116 C501(0.88); C502(0.98); C574(0.44); C67(1.13)  LDD0762  [3]
 LDCM0446  CL55 HCT 116 C501(0.90); C502(0.97); C574(0.43); C67(1.03)  LDD0763  [3]
 LDCM0447  CL56 HCT 116 C501(0.94); C502(1.02); C574(0.57); C67(1.35)  LDD0764  [3]
 LDCM0448  CL57 HCT 116 C501(1.08); C502(1.03); C574(0.48); C67(1.26)  LDD0765  [3]
 LDCM0449  CL58 HCT 116 C501(0.92); C502(0.99); C574(0.53); C67(1.25)  LDD0766  [3]
 LDCM0450  CL59 HCT 116 C501(1.14); C502(1.08); C574(0.50); C67(1.10)  LDD0767  [3]
 LDCM0451  CL6 HCT 116 C380(0.97); C501(0.88); C502(0.88); C574(0.55)  LDD0768  [3]
 LDCM0452  CL60 HCT 116 C501(0.88); C502(1.01); C574(0.43); C67(1.08)  LDD0769  [3]
 LDCM0453  CL61 HCT 116 C380(1.03); C501(0.87); C502(0.91); C67(0.91)  LDD0770  [3]
 LDCM0454  CL62 HCT 116 C380(0.91); C501(0.81); C502(0.79); C67(0.93)  LDD0771  [3]
 LDCM0455  CL63 HCT 116 C380(0.83); C501(0.81); C502(0.79); C67(0.94)  LDD0772  [3]
 LDCM0456  CL64 HCT 116 C380(0.71); C501(0.87); C502(0.85); C67(0.84)  LDD0773  [3]
 LDCM0457  CL65 HCT 116 C380(0.76); C501(0.88); C502(0.84); C67(0.88)  LDD0774  [3]
 LDCM0458  CL66 HCT 116 C380(0.85); C501(0.91); C502(0.88); C67(0.90)  LDD0775  [3]
 LDCM0459  CL67 HCT 116 C380(0.71); C501(0.95); C502(0.93); C67(1.01)  LDD0776  [3]
 LDCM0460  CL68 HCT 116 C380(0.57); C501(0.78); C502(0.78); C67(1.22)  LDD0777  [3]
 LDCM0461  CL69 HCT 116 C380(0.89); C501(0.84); C502(0.85); C67(0.94)  LDD0778  [3]
 LDCM0462  CL7 HCT 116 C380(1.04); C501(1.02); C502(0.98); C574(0.44)  LDD0779  [3]
 LDCM0463  CL70 HCT 116 C380(0.70); C501(0.83); C502(0.79); C67(0.97)  LDD0780  [3]
 LDCM0464  CL71 HCT 116 C380(0.77); C501(0.87); C502(0.90); C67(1.12)  LDD0781  [3]
 LDCM0465  CL72 HCT 116 C380(1.00); C501(0.89); C502(0.92); C67(0.99)  LDD0782  [3]
 LDCM0466  CL73 HCT 116 C380(0.94); C501(0.83); C502(0.84); C67(1.04)  LDD0783  [3]
 LDCM0467  CL74 HCT 116 C380(0.70); C501(0.89); C502(0.85); C67(1.02)  LDD0784  [3]
 LDCM0469  CL76 HCT 116 C380(0.72); C501(0.95); C502(0.95); C67(1.17)  LDD0786  [3]
 LDCM0470  CL77 HCT 116 C380(0.82); C501(1.00); C502(1.00); C67(1.20)  LDD0787  [3]
 LDCM0471  CL78 HCT 116 C380(0.92); C501(0.90); C502(0.90); C67(1.05)  LDD0788  [3]
 LDCM0472  CL79 HCT 116 C380(0.77); C501(1.02); C502(1.02); C67(1.17)  LDD0789  [3]
 LDCM0473  CL8 HCT 116 C380(0.99); C501(1.03); C502(1.07); C574(0.60)  LDD0790  [3]
 LDCM0474  CL80 HCT 116 C380(0.87); C501(0.92); C502(0.92); C67(0.95)  LDD0791  [3]
 LDCM0475  CL81 HCT 116 C380(0.89); C501(1.05); C502(1.05); C67(1.04)  LDD0792  [3]
 LDCM0476  CL82 HCT 116 C380(1.01); C501(1.05); C502(1.05); C67(1.08)  LDD0793  [3]
 LDCM0477  CL83 HCT 116 C380(0.94); C501(1.04); C502(1.04); C67(1.12)  LDD0794  [3]
 LDCM0478  CL84 HCT 116 C380(0.87); C501(1.00); C502(1.00); C67(1.14)  LDD0795  [3]
 LDCM0479  CL85 HCT 116 C380(0.87); C501(1.03); C502(1.03); C67(1.23)  LDD0796  [3]
 LDCM0480  CL86 HCT 116 C380(0.99); C501(1.00); C502(1.00); C67(1.13)  LDD0797  [3]
 LDCM0481  CL87 HCT 116 C380(0.91); C501(1.08); C502(1.08); C67(1.06)  LDD0798  [3]
 LDCM0482  CL88 HCT 116 C380(0.90); C501(1.16); C502(1.16); C67(1.16)  LDD0799  [3]
 LDCM0483  CL89 HCT 116 C380(0.89); C501(0.99); C502(0.99); C67(1.11)  LDD0800  [3]
 LDCM0484  CL9 HCT 116 C380(0.93); C501(1.05); C502(1.09); C574(0.58)  LDD0801  [3]
 LDCM0485  CL90 HCT 116 C380(0.83); C501(1.10); C502(1.10); C67(1.16)  LDD0802  [3]
 LDCM0486  CL91 HCT 116 C380(0.91); C501(1.09); C502(1.28); C574(1.07)  LDD0803  [3]
 LDCM0487  CL92 HCT 116 C380(1.03); C501(1.08); C502(1.10); C574(1.01)  LDD0804  [3]
 LDCM0488  CL93 HCT 116 C380(1.00); C501(1.15); C502(0.99); C574(0.81)  LDD0805  [3]
 LDCM0489  CL94 HCT 116 C380(0.80); C501(1.27); C502(1.02); C574(1.22)  LDD0806  [3]
 LDCM0490  CL95 HCT 116 C380(1.26); C501(1.12); C502(1.17); C574(0.97)  LDD0807  [3]
 LDCM0491  CL96 HCT 116 C380(1.10); C501(1.24); C502(1.30); C574(0.91)  LDD0808  [3]
 LDCM0492  CL97 HCT 116 C380(1.11); C501(1.41); C502(1.40); C574(0.84)  LDD0809  [3]
 LDCM0493  CL98 HCT 116 C380(1.18); C501(1.26); C502(1.16); C574(0.85)  LDD0810  [3]
 LDCM0494  CL99 HCT 116 C380(0.91); C501(1.47); C502(1.16); C574(0.67)  LDD0811  [3]
 LDCM0634  CY-0357 Hep-G2 C67(50.00)  LDD2228  [8]
 LDCM0495  E2913 HEK-293T C574(1.02); C67(1.08); C326(1.17); C268(1.07)  LDD1698  [15]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C574(1.05); C502(0.73)  LDD1702  [2]
 LDCM0625  F8 Ramos C380(1.18); C67(0.78); C574(2.23)  LDD2187  [16]
 LDCM0572  Fragment10 Ramos C380(1.06); C67(4.56); C574(1.03)  LDD2189  [16]
 LDCM0573  Fragment11 Ramos C380(1.58); C574(0.71)  LDD2190  [16]
 LDCM0574  Fragment12 Ramos C380(1.12); C67(1.33); C574(0.88)  LDD2191  [16]
 LDCM0575  Fragment13 Ramos C380(1.02); C67(0.44); C574(0.99)  LDD2192  [16]
 LDCM0576  Fragment14 Ramos C380(1.14); C67(0.78)  LDD2193  [16]
 LDCM0579  Fragment20 Ramos C380(1.08); C67(0.80); C574(0.64)  LDD2194  [16]
 LDCM0580  Fragment21 Ramos C380(1.39); C67(0.87); C574(1.12)  LDD2195  [16]
 LDCM0582  Fragment23 Ramos C67(0.58); C574(0.58)  LDD2196  [16]
 LDCM0578  Fragment27 Ramos C67(0.36); C574(1.33)  LDD2197  [16]
 LDCM0586  Fragment28 Ramos C380(0.25); C574(0.84)  LDD2198  [16]
 LDCM0588  Fragment30 Ramos C380(1.48); C67(1.29); C574(1.22)  LDD2199  [16]
 LDCM0589  Fragment31 Ramos C380(1.17); C67(0.72); C574(1.31)  LDD2200  [16]
 LDCM0590  Fragment32 Ramos C380(1.15)  LDD2201  [16]
 LDCM0468  Fragment33 HCT 116 C380(0.78); C501(0.90); C502(0.91); C67(0.86)  LDD0785  [3]
 LDCM0596  Fragment38 Ramos C380(1.29); C67(0.54); C574(1.61)  LDD2203  [16]
 LDCM0566  Fragment4 Ramos C380(1.10); C67(0.86); C574(1.35)  LDD2184  [16]
 LDCM0427  Fragment51 HCT 116 C380(1.03); C501(0.94); C502(0.94); C574(0.66)  LDD0744  [3]
 LDCM0610  Fragment52 Ramos C380(0.95); C67(0.45); C574(0.91)  LDD2204  [16]
 LDCM0614  Fragment56 Ramos C380(1.51); C67(0.52)  LDD2205  [16]
 LDCM0569  Fragment7 Ramos C380(1.13); C67(0.99); C574(1.12)  LDD2186  [16]
 LDCM0571  Fragment9 Ramos C380(0.87); C574(0.72)  LDD2188  [16]
 LDCM0022  KB02 HCT 116 C67(3.32); C380(1.25); C574(1.22)  LDD0080  [3]
 LDCM0023  KB03 HCT 116 C67(1.57); C380(1.28); C574(0.88)  LDD0081  [3]
 LDCM0024  KB05 HCT 116 C67(1.69); C380(1.64); C574(1.19)  LDD0082  [3]
 LDCM0506  Nucleophilic fragment 16a MDA-MB-231 C502(0.64)  LDD2099  [2]
 LDCM0511  Nucleophilic fragment 18b MDA-MB-231 C502(0.97); C574(0.89)  LDD2104  [2]
 LDCM0512  Nucleophilic fragment 19a MDA-MB-231 C502(0.71)  LDD2105  [2]
 LDCM0514  Nucleophilic fragment 20a MDA-MB-231 C502(0.85)  LDD2107  [2]
 LDCM0521  Nucleophilic fragment 23b MDA-MB-231 C501(0.90)  LDD2114  [2]
 LDCM0525  Nucleophilic fragment 25b MDA-MB-231 C574(0.51)  LDD2118  [2]
 LDCM0529  Nucleophilic fragment 27b MDA-MB-231 C502(1.03)  LDD2122  [2]
 LDCM0530  Nucleophilic fragment 28a MDA-MB-231 C502(0.87)  LDD2123  [2]
 LDCM0532  Nucleophilic fragment 29a MDA-MB-231 C502(0.61)  LDD2125  [2]
 LDCM0534  Nucleophilic fragment 30a MDA-MB-231 C502(0.68); C574(1.22)  LDD2127  [2]
 LDCM0543  Nucleophilic fragment 38 MDA-MB-231 C502(0.95); C574(0.94)  LDD2136  [2]
 LDCM0211  Nucleophilic fragment 3b MDA-MB-231 C501(0.51)  LDD1700  [2]
 LDCM0547  Nucleophilic fragment 41 MDA-MB-231 C574(0.86)  LDD2141  [2]
 LDCM0021  THZ1 HCT 116 C380(1.23); C67(1.13)  LDD2173  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 18 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Histone acetyltransferase KAT2B (KAT2B) Acetyltransferase family Q92831
Casein kinase II subunit beta (CSNK2B) Casein kinase 2 subunit beta family P67870
DNA (cytosine-5)-methyltransferase 1 (DNMT1) C5-methyltransferase family P26358
Histone-lysine N-methyltransferase SETD7 (SETD7) Histone-lysine methyltransferase family Q8WTS6
Histone-lysine N-methyltransferase SUV39H1 (SUV39H1) Histone-lysine methyltransferase family O43463
Histone-lysine N-methyltransferase 2A (KMT2A) Histone-lysine methyltransferase family Q03164
DNA repair nuclease/redox regulator APEX1 (APEX1) DNA repair enzymes AP/ExoA family P27695
Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 (NMNAT1) Eukaryotic NMN adenylyltransferase family Q9HAN9
Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN (WRN) Helicase family Q14191
X-ray repair cross-complementing protein 6 (XRCC6) Ku70 family P12956
Ribosomal RNA-processing protein 8 (RRP8) RRP8 family O43159
Serine/threonine-protein kinase mTOR (MTOR) PI3/PI4-kinase family P42345
RAC-alpha serine/threonine-protein kinase (AKT1) AGC Ser/Thr protein kinase family P31749
Casein kinase II subunit alpha (CSNK2A1) Ser/Thr protein kinase family P68400
Acetyl-CoA carboxylase 1 (ACACA) . Q13085
Histone acetyltransferase p300 (EP300) . Q09472
Histone-lysine N-methyltransferase MECOM (MECOM) . Q03112
MHC class II transactivator (CIITA) . P33076
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ubiquitin-like modifier-activating enzyme ATG7 (ATG7) ATG7 family O95352
Hairy/enhancer-of-split related with YRPW motif protein 2 (HEY2) HEY family Q9UBP5
Cellular tumor antigen p53 (TP53) P53 family P04637
Transcription factor
Click To Hide/Show 14 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CREB/ATF bZIP transcription factor (CREBZF) BZIP family Q9NS37
Transcription factor E2F1 (E2F1) E2F/DP family Q01094
Nuclear receptor subfamily 0 group B member 2 (NR0B2) Nuclear hormone receptor family Q15466
Peroxisome proliferator-activated receptor gamma (PPARG) Nuclear hormone receptor family P37231
Retinoic acid receptor alpha (RARA) Nuclear hormone receptor family P10276
Tumor protein p73 (TP73) P53 family O15350
Forkhead box protein O1 (FOXO1) . Q12778
Forkhead box protein O3 (FOXO3) . O43524
Forkhead box protein O4 (FOXO4) . P98177
Helix-loop-helix protein 2 (NHLH2) . Q02577
Myc proto-oncogene protein (MYC) . P01106
N-myc proto-oncogene protein (MYCN) . P04198
Transcription factor HES-1 (HES1) . Q14469
Transcription factor p65 (RELA) . Q04206
Other
Click To Hide/Show 16 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Active regulator of SIRT1 (RPS19BP1) AROS family Q86WX3
Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) ATG8 family Q9GZQ8
Segment polarity protein dishevelled homolog DVL-1 (DVL1) DSH family O14640
Segment polarity protein dishevelled homolog DVL-3 (DVL3) DSH family Q92997
Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1) PI3K p85 subunit family P27986
SNW domain-containing protein 1 (SNW1) SNW family Q13573
Transducin-like enhancer protein 1 (TLE1) WD repeat Groucho/TLE family Q04724
Regulatory-associated protein of mTOR (RPTOR) WD repeat RAPTOR family Q8N122
DNA repair protein complementing XP-A cells (XPA) XPA family P23025
Cell cycle and apoptosis regulator protein 2 (CCAR2) . Q8N163
Chondrosarcoma-associated gene 2/3 protein (CSAG2; CSAG3) . Q9Y5P2
Four and a half LIM domains protein 2 (FHL2) . Q14192
Host cell factor 1 (HCFC1) . P51610
Insulin receptor substrate 2 (IRS2) . Q9Y4H2
Nibrin (NBN) . O60934
Tuberin (TSC2) . P49815

The Drug(s) Related To This Target

Phase 3
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Resveratrol Small molecular drug D0U3EP
Phase 2
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Gsk2245840 Small molecular drug D04JNI
Sen-196 Small molecular drug D0E3LP
Mb-12066 . D0TU7V
Phase 1
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Srt2379 . D0O3EP
Srt3025 . D0X3TI
Investigative
Click To Hide/Show 13 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
(R)-sirtinol Small molecular drug D02EWM
(S)-sirtinol Small molecular drug D0F1KR
2,3,4,9-tetrahydro-1h-carbazole-1-carboxamide Small molecular drug D0E1QP
2h-chromeno[2,3-d]Pyrimidine-2,4(3h)-dione Small molecular drug D02AYX
Cambinol Small molecular drug DB15493
Meta-sirtinol Small molecular drug D00LYI
Para-sirtinol Small molecular drug D0UO1E
Ro-316233 Small molecular drug D0L8HO
Ro31-8220 Small molecular drug D0M5FF
Splitomicin Small molecular drug D09SUO
Srt1720 Small molecular drug D03EGA
Selisistat . DB13978
Yk-3237 . D05UDU
Patented
Click To Hide/Show 4 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Pmid25435179-compound-wo2012106509tenovin-6 RNA D0PE8E
Cambinol Small molecular drug D04JZE
Pmid25435179-compound-wo2012106509cay10602 . D06IHB
Pmid25435179-compound-wo2012106509salermide . D02QKC
Discontinued
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Gsk184072 Small molecular drug D0R3EL

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
3 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
4 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
5 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
6 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
7 SP3-Enabled Rapid and High Coverage Chemoproteomic Identification of Cell-State-Dependent Redox-Sensitive Cysteines. Mol Cell Proteomics. 2022 Apr;21(4):100218. doi: 10.1016/j.mcpro.2022.100218. Epub 2022 Feb 25.
Mass spectrometry data entry: PXD029500 , PXD031647
8 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
9 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
10 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279
11 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
12 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
13 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
14 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
15 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
16 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578