Details of the Target
General Information of Target
| Target ID | LDTP10113 | |||||
|---|---|---|---|---|---|---|
| Target Name | Mitochondrial import receptor subunit TOM6 homolog (TOMM6) | |||||
| Gene Name | TOMM6 | |||||
| Gene ID | 100188893 | |||||
| Synonyms |
OBTP; TOM6; Mitochondrial import receptor subunit TOM6 homolog; Overexpressed breast tumor protein; Translocase of outer membrane 6 kDa subunit homolog |
|||||
| 3D Structure | ||||||
| Sequence |
MPSAFSVSSFPVSIPAVLTQTDWTEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLV
ILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVM TDLKNAQERRKEKKRRRKED |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Tom6 family
|
|||||
| Subcellular location |
Mitochondrion outer membrane
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C053 Probe Info |
![]() |
9.85 | LDD1751 | [1] | |
|
C106 Probe Info |
![]() |
28.44 | LDD1793 | [1] | |
|
C107 Probe Info |
![]() |
6.45 | LDD1794 | [1] | |
|
C112 Probe Info |
![]() |
99.73 | LDD1799 | [1] | |
|
C231 Probe Info |
![]() |
12.47 | LDD1904 | [1] | |
|
C232 Probe Info |
![]() |
36.76 | LDD1905 | [1] | |
|
C235 Probe Info |
![]() |
18.13 | LDD1908 | [1] | |
|
C293 Probe Info |
![]() |
60.13 | LDD1963 | [1] | |
|
C296 Probe Info |
![]() |
23.26 | LDD1966 | [1] | |
|
C390 Probe Info |
![]() |
91.14 | LDD2049 | [1] | |
|
C429 Probe Info |
![]() |
35.75 | LDD2084 | [1] | |
|
C431 Probe Info |
![]() |
60.13 | LDD2086 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Ceramide synthase 4 (CERS4) | . | Q9HA82 | |||
Transporter and channel
GPCR
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Free fatty acid receptor 3 (FFAR3) | G-protein coupled receptor 1 family | O14843 | |||
Other












