Details of the Target

General Information of Target

Target ID LDTP09970
Target Name RNA-binding protein with multiple splicing (RBPMS)
Gene Name RBPMS
Gene ID 11030
Synonyms
HERMES; RNA-binding protein with multiple splicing; RBP-MS; RBPMS; Heart and RRM expressed sequence; Hermes
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSHPSWLPPKSTGEPLGHVPARMETTHSFGNPSISVSTQQPPKKFAPVVAPKPKYNPYKQ
PGGEGDFLPPPPPPLDDSSALPSISGNFPPPPPLDEEAFKVQGNPGGKTLEERRSSLDAE
IDSLTSILADLECSSPYKPRPPQSSTGSTASPPVSTPVTGHKRMVIPNQPPLTATKKSTL
KPQPAPQAGPIPVAPIGTLKPQPQPVPASYTTASTSSRPTFNVQVKSAQPSPHYMAAPSS
GQIYGSGPQGYNTQPVPVSGQCPPPSTRGGMDYAYIPPPGLQPEPGYGYAPNQGRYYEGY
YAAGPGYGGRNDSDPTYGQQGHPNTWKREPGYTPPGAGNQNPPGMYPVTGPKKTYITDPV
SAPCAPPLQPKGGHSGQLGPSSVAPSFRPEDELEHLTKKMLYDMENPPADEYFGRCARCG
ENVVGEGTGCTAMDQVFHVDCFTCIICNNKLRGQPFYAVEKKAYCEPCYINTLEQCNVCS
KPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDAGGLIHCIEDFHKKFAPRCSVCK
EPIMPAPGQEETVRIVALDRDFHVHCYRCEDCGGLLSEGDNQGCYPLDGHILCKTCNSAR
IRVLTAKASTDL
Target Bioclass
Other
Subcellular location
Nucleus
Function
[Isoform A]: RNA binding protein that mediates the regulation of pre-mRNA alternative splicing (AS). Acts either as activator (FLNB, HSPG2, LIPA1, MYOCD, PTPRF and PPFIBP1) or repressor (TPM1, ACTN1, ITGA7, PIEZO1, LSM14B, MBNL1 and MBML2) of splicing events on specific pre-mRNA targets. Together with RNA binding proteins RBFOX2 and MBNL1/2, activates a splicing program associated with differentiated contractile vascular smooth muscle cells (SMC) by regulating AS of numerous pre-mRNA involved in actin cytoskeleton and focal adhesion machineries, suggesting a role in promoting a cell differentiated state. Binds to introns, exons and 3'-UTR associated with tandem CAC trinucleotide motifs separated by a variable spacer region, at a minimum as a dimer. The minimal length of RNA required for RBPMS-binding tandem CAC motifs is 15 nt, with spacing ranging from 1 to 9 nt. Can also bind to CA dinucleotide repeats. Mediates repression of TPM1 exon 3 by binding to CAC tandem repeats in the flanking intronic regions, followed by higher-order oligomerization and heterotypic interactions with other splicing regulators including MBNL1 and RBFOX2, which prevents assembly of ATP-dependent splicing complexes.; [Isoform C]: Acts as a regulator of pre-mRNA alternative splicing (AS). Binds mRNA. Regulates AS of ACTN1, FLNB, although with lower efficiency than isoform A / RBPMSA. Acts as coactivator of SMAD transcriptional activity in a TGFB1-dependent manner, possibly through increased phosphorylation of SMAD2 and SMAD3 at the C-terminal SSXS regions and promotion of the nuclear accumulation of SMAD proteins.
Uniprot ID
Q93062
Ensemble ID
ENST00000287771.9
HGNC ID
HGNC:19097

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
NCIH446 SNV: p.P155Q .
SJSA1 SNV: p.R85H .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
YN-1
 Probe Info  		100.00  LDD0444  [1]
PAL-AfBPP Probe
Click To Hide/Show 11 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C165
 Probe Info  		13.00  LDD1845  [2]
C166
 Probe Info  		8.46  LDD1846  [2]
C251
 Probe Info  		36.76  LDD1924  [2]
C252
 Probe Info  		17.15  LDD1925  [2]
C255
 Probe Info  		5.46  LDD1928  [2]
C285
 Probe Info  		20.11  LDD1955  [2]
C286
 Probe Info  		4.96  LDD1956  [2]
C287
 Probe Info  		9.99  LDD1957  [2]
C288
 Probe Info  		7.01  LDD1958  [2]
C289
 Probe Info  		41.64  LDD1959  [2]
C290
 Probe Info  		5.10  LDD1960  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 28 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 5'-AMP-activated protein kinase beta subunit family O43741
Paraplegin (SPG7) AAA ATPase family; Peptidase M41 family Q9UQ90
Cell division cycle protein 23 homolog (CDC23) APC8/CDC23 family Q9UJX2
Probable E3 ubiquitin-protein ligase DTX2 (DTX2) Deltex family Q86UW9
Poly(A) RNA polymerase GLD2 (TENT2) DNA polymerase type-B-like family Q6PIY7
Glycerate kinase (GLYCTK) Glycerate kinase type-2 family Q8IVS8
Ribonuclease P protein subunit p25 (RPP25) Histone-like Alba family Q9BUL9
Inositol hexakisphosphate kinase 2 (IP6K2) Inositol phosphokinase (IPK) family Q9UHH9
Kappa-casein (CSN3) Kappa-casein family P07498
Dihydropyrimidinase-related protein 4 (DPYSL4) Hydantoinase/dihydropyrimidinase family O14531
Nicotinate phosphoribosyltransferase (NAPRT) NAPRTase family Q6XQN6
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
ATP-dependent Clp protease proteolytic subunit, mitochondrial (CLPP) Peptidase S14 family Q16740
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A) CAMK Ser/Thr protein kinase family Q9UQM7
Calcium/calmodulin-dependent protein kinase type II subunit beta (CAMK2B) CAMK Ser/Thr protein kinase family Q13554
5'-AMP-activated protein kinase catalytic subunit alpha-1 (PRKAA1) CAMK Ser/Thr protein kinase family Q13131
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2) CAMK Ser/Thr protein kinase family P54646
Tyrosine-protein kinase receptor Tie-1 (TIE1) Tyr protein kinase family P35590
Myotubularin-related protein 13 (SBF2) Protein-tyrosine phosphatase family Q86WG5
Retinol dehydrogenase 12 (RDH12) Short-chain dehydrogenases/reductases (SDR) family Q96NR8
Helicase ARIP4 (RAD54L2) SNF2/RAD54 helicase family Q9Y4B4
Single-strand selective monofunctional uracil DNA glycosylase (SMUG1) SMUG1 family Q53HV7
DDB1- and CUL4-associated factor 8 (DCAF8) WD repeat DCAF8 family Q5TAQ9
Ataxin-3 (ATXN3) . P54252
Disintegrin and metalloproteinase domain-containing protein 15 (ADAM15) . Q13444
LON peptidase N-terminal domain and RING finger protein 1 (LONRF1) . Q17RB8
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) . Q13526
Rho-related BTB domain-containing protein 3 (RHOBTB3) . O94955
Transporter and channel
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Metal transporter CNNM3 (CNNM3) ACDP family Q8NE01
Protein cereblon (CRBN) CRBN family Q96SW2
Hairy/enhancer-of-split related with YRPW motif protein 2 (HEY2) HEY family Q9UBP5
Huntingtin (HTT) Huntingtin family P42858
Importin subunit alpha-1 (KPNA2) Importin alpha family P52292
Phospholipid scramblase 4 (PLSCR4) Phospholipid scramblase family Q9NRQ2
Nuclear envelope pore membrane protein POM 121 (POM121) POM121 family Q96HA1
Bardet-Biedl syndrome 2 protein (BBS2) . Q9BXC9
Transcription factor
Click To Hide/Show 24 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Doublesex- and mab-3-related transcription factor 3 (DMRT3) DMRT family Q9NQL9
Zinc finger protein GLIS2 (GLIS2) GLI C2H2-type zinc-finger protein family Q9BZE0
Zinc finger protein ZIC 1 (ZIC1) GLI C2H2-type zinc-finger protein family Q15915
Hairy/enhancer-of-split related with YRPW motif-like protein (HEYL) HEY family Q9NQ87
Vascular endothelial zinc finger 1 (VEZF1) Krueppel C2H2-type zinc-finger protein family Q14119
Homeobox protein MSX-1 (MSX1) Msh homeobox family P28360
Homeobox protein Nkx-2.5 (NKX2-5) NK-2 homeobox family P52952
Homeobox protein OTX1 (OTX1) Paired homeobox family P32242
Pituitary homeobox 1 (PITX1) Paired homeobox family P78337
Rhox homeobox family member 2 (RHOXF2) Paired-like homeobox family Q9BQY4
PHD finger protein 1 (PHF1) Polycomblike family O43189
POU domain, class 4, transcription factor 2 (POU4F2) POU transcription factor family Q12837
POU domain, class 6, transcription factor 2 (POU6F2) POU transcription factor family P78424
AT-rich interactive domain-containing protein 5A (ARID5A) . Q03989
Chorion-specific transcription factor GCMb (GCM2) . O75603
Class E basic helix-loop-helix protein 40 (BHLHE40) . O14503
Endothelial transcription factor GATA-2 (GATA2) . P23769
Forkhead box protein C2 (FOXC2) . Q99958
Forkhead box protein P3 (FOXP3) . Q9BZS1
Homeobox protein VENTX (VENTX) . O95231
Pogo transposable element with ZNF domain (POGZ) . Q7Z3K3
T-box transcription factor TBX6 (TBX6) . O95947
Zinc finger protein 581 (ZNF581) . Q9P0T4
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Killer cell immunoglobulin-like receptor 2DL4 (KIR2DL4) Immunoglobulin superfamily Q99706
Other
Click To Hide/Show 89 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ataxin-1 (ATXN1) ATXN1 family P54253
Protein BANP (BANP) BANP/SMAR1 family Q8N9N5
Beta-crystallin A3 (CRYBA1) Beta/gamma-crystallin family P05813
Enhancer of filamentation 1 (NEDD9) CAS family Q14511
Cyclin-K (CCNK) Cyclin family O75909
Cyclin-G1 (CCNG1) Cyclin family P51959
Docking protein 3 (DOK3) DOK family Q7L591
Docking protein 6 (DOK6) DOK family, Type B subfamily Q6PKX4
Dynactin subunit 5 (DCTN5) Dynactin subunits 5/6 family Q9BTE1
Protein FAM124B (FAM124B) FAM124 family Q9H5Z6
Protein FAM168A (FAM168A) FAM168 family Q92567
EGF-containing fibulin-like extracellular matrix protein 2 (EFEMP2) Fibulin family O95967
GRB2-related adapter protein (GRAP) GRB2/sem-5/DRK family Q13588
Protein INCA1 (INCA1) INCA family Q0VD86
Insulin-like growth factor II (IGF2) Insulin family P01344
Keratin-associated protein 12-1 (KRTAP12-1) KRTAP type 12 family P59990
Keratin-associated protein 12-2 (KRTAP12-2) KRTAP type 12 family P59991
Keratin-associated protein 12-4 (KRTAP12-4) KRTAP type 12 family P60329
Keratin-associated protein 19-1 (KRTAP19-1) KRTAP type 19 family Q8IUB9
Keratin-associated protein 19-3 (KRTAP19-3) KRTAP type 19 family Q7Z4W3
Keratin-associated protein 19-5 (KRTAP19-5) KRTAP type 19 family Q3LI72
Keratin-associated protein 19-7 (KRTAP19-7) KRTAP type 19 family Q3SYF9
Keratin-associated protein 3-1 (KRTAP3-1) KRTAP type 3 family Q9BYR8
Keratin-associated protein 8-1 (KRTAP8-1) KRTAP type 8 family Q8IUC2
Zinc finger protein 488 (ZNF488) Krueppel C2H2-type zinc-finger protein family Q96MN9
Myozenin-2 (MYOZ2) Myozenin family Q9NPC6
Testis-specific Y-encoded-like protein 6 (TSPYL6) Nucleosome assembly protein (NAP) family Q8N831
PIH1 domain-containing protein 1 (PIH1D1) PIH1 family Q9NWS0
Keratin-associated protein 11-1 (KRTAP11-1) PMG family Q8IUC1
Keratin-associated protein 13-3 (KRTAP13-3) PMG family Q3SY46
Keratin-associated protein 15-1 (KRTAP15-1) PMG family Q3LI76
Keratin-associated protein 26-1 (KRTAP26-1) PMG family Q6PEX3
Proline-rich protein 20C (PRR20C) PRR20 family P86479
Proline-rich protein 20D (PRR20D) PRR20 family P86480
Protein ripply1 (RIPPLY1) Ripply family Q0D2K3
Protein boule-like (BOLL) RRM DAZ family Q8N9W6
Sperm microtubule inner protein 6 (SPMIP6) SMRP1 family Q8NCR6
SOSS complex subunit C (INIP) SOSS-C family Q9NRY2
Tektin-5 (TEKT5) Tektin family Q96M29
Transcription elongation factor A protein 2 (TCEA2) TFS-II family Q15560
Toll-interacting protein (TOLLIP) Tollip family Q9H0E2
Tumor suppressor candidate 2 (TUSC2) TUSC2 family O75896
U1 small nuclear ribonucleoprotein C (SNRPC) U1 small nuclear ribonucleoprotein C family P09234
Synaptic plasticity regulator PANTS (C22orf39) UPF0545 family Q6P5X5
von Hippel-Lindau-like protein (VHLL) VHL family Q6RSH7
Vacuolar protein sorting-associated protein 37C (VPS37C) VPS37 family A5D8V6
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
WD repeat-containing protein 90 (WDR90) WD repeat WDR90/POC16 family Q96KV7
AP-4 complex accessory subunit RUSC1 (RUSC1) . Q9BVN2
BTB/POZ domain-containing protein KCTD9 (KCTD9) . Q7L273
Ciliary microtubule inner protein 1 (CIMIP1) . Q9H1P6
Coiled-coil domain-containing protein 120 (CCDC120) . Q96HB5
Collagen alpha-1(VIII) chain (COL8A1) . P27658
DAZ-associated protein 2 (DAZAP2) . Q15038
Doublecortin domain-containing protein 2B (DCDC2B) . A2VCK2
Fibronectin type III domain-containing protein 11 (FNDC11) . Q9BVV2
G patch domain-containing protein 2-like (GPATCH2L) . Q9NWQ4
G protein pathway suppressor 2 (GPS2) . Q13227
Galectin-9C (LGALS9C) . Q6DKI2
Genetic suppressor element 1 (GSE1) . Q14687
Heterogeneous nuclear ribonucleoprotein L-like (HNRNPLL) . Q8WVV9
Inactive polyglycylase TTLL10 (TTLL10) . Q6ZVT0
Kelch domain-containing protein 7B (KLHDC7B) . Q96G42
Keratin-associated protein 23-1 (KRTAP23-1) . A1A580
KH domain-containing RNA-binding protein QKI (QKI) . Q96PU8
LIM domain transcription factor LMO4 (LMO4) . P61968
Melanoma-associated antigen D1 (MAGED1) . Q9Y5V3
Nuclear protein AMMECR1 (AMMECR1) . Q9Y4X0
Proline-rich protein 35 (PRR35) . P0CG20
Protein SPMIP9 (SPMIP9) . Q96LM6
Protein TFG (TFG) . Q92734
Putative insulin-like growth factor 2-associated protein . P09565
Putative uncharacterized protein encoded by LINC00482 (LINC00482) . Q8N8I6
Putative uncharacterized protein encoded by LINC00588 (LINC00588) . Q9Y4M8
Receptor-transporting protein 5 (RTP5) . Q14D33
RNA binding protein fox-1 homolog 1 (RBFOX1) . Q9NWB1
RNA-binding protein with multiple splicing 2 (RBPMS2) . Q6ZRY4
Spermatid perinuclear RNA-binding protein (STRBP) . Q96SI9
Spermatogenesis-associated protein 46 (SPATA46) . Q5T0L3
Spermatogenesis-associated protein 8 (SPATA8) . Q6RVD6
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00
Torsin-1A-interacting protein 2, isoform IFRG15 (TOR1AIP2) . Q9H496
Transmembrane protein 42 (TMEM42) . Q69YG0
Ubiquitin-associated protein 2 (UBAP2) . Q5T6F2
Uncharacterized protein C10orf55 (C10orf55) . Q5SWW7
Uncharacterized protein C11orf87 (C11orf87) . Q6NUJ2
Uncharacterized protein C1orf94 (C1orf94) . Q6P1W5
Zinc finger CCCH domain-containing protein 10 (ZC3H10) . Q96K80
Zinc finger protein 385C (ZNF385C) . Q66K41

References

1 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
2 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587