Details of the Target

General Information of Target

Target ID LDTP06450
Target Name ELAV-like protein 1 (ELAVL1)
Gene Name ELAVL1
Gene ID 1994
Synonyms
HUR; ELAV-like protein 1; Hu-antigen R; HuR
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHS
LGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQK
DVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPIT
VKFAANPNQNKNVALLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPGNA
SSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAM
AIASLNGYRLGDKILQVSFKTNKSHK
Target Type
Literature-reported
Target Bioclass
Other
Family
RRM elav family
Subcellular location
Cytoplasm
Function
RNA-binding protein that binds to the 3'-UTR region of mRNAs and increases their stability. Involved in embryonic stem cell (ESC) differentiation: preferentially binds mRNAs that are not methylated by N6-methyladenosine (m6A), stabilizing them, promoting ESC differentiation. Has also been shown to be capable of binding to m6A-containing mRNAs and contributes to MYC stability by binding to m6A-containing MYC mRNAs. Binds to poly-U elements and AU-rich elements (AREs) in the 3'-UTR of target mRNAs. Binds avidly to the AU-rich element in FOS and IL3/interleukin-3 mRNAs. In the case of the FOS AU-rich element, binds to a core element of 27 nucleotides that contain AUUUA, AUUUUA, and AUUUUUA motifs. Binds preferentially to the 5'-UUUU[AG]UUU-3' motif in vitro. With ZNF385A, binds the 3'-UTR of p53/TP53 mRNA to control their nuclear export induced by CDKN2A. Hence, may regulate p53/TP53 expression and mediate in part the CDKN2A anti-proliferative activity. May also bind with ZNF385A the CCNB1 mRNA. Increases the stability of the leptin mRNA harboring an AU-rich element (ARE) in its 3' UTR.
TTD ID
T78349
Uniprot ID
Q15717
DrugMap ID
TTPC9D0
Ensemble ID
ENST00000407627.7
HGNC ID
HGNC:3312
ChEMBL ID
CHEMBL1250379

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HEC1B SNV: p.A269V .
LNCaP clone FGC SNV: p.V24A .
REH SNV: p.A299T .
RKO SNV: p.M292T .
RL952 Insertion: p.A77EfsTer6 .
SKMEL2 SNV: p.V149I .
UMUC3 SNV: p.S176C .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 33 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
A-EBA
 Probe Info  		3.85  LDD0215  [2]
CY-1
 Probe Info  		100.00  LDD0243  [3]
CY4
 Probe Info  		100.00  LDD0244  [3]
W1
 Probe Info  		17.09  LDD0235  [4]
TH211
 Probe Info  		Y200(5.47)  LDD0257  [5]
YN-1
 Probe Info  		100.00  LDD0444  [6]
STPyne
 Probe Info  		K191(5.77); K320(10.00); K50(4.20)  LDD0277  [7]
BTD
 Probe Info  		C284(1.30)  LDD1700  [8]
EA-probe
 Probe Info  		N.A.  LDD0440  [9]
HHS-482
 Probe Info  		Y200(0.16)  LDD0291  [10]
HHS-465
 Probe Info  		Y26(8.96)  LDD2237  [11]
Acrolein
 Probe Info  		H213(0.00); H212(0.00)  LDD0221  [12]
5E-2FA
 Probe Info  		H59(0.00); H212(0.00); H201(0.00); H170(0.00)  LDD2235  [13]
ATP probe
 Probe Info  		K50(0.00); K320(0.00); K323(0.00); K104(0.00)  LDD0199  [14]
IA-alkyne
 Probe Info  		N.A.  LDD0032  [15]
IPIAA_H
 Probe Info  		N.A.  LDD0030  [16]
IPIAA_L
 Probe Info  		N.A.  LDD0031  [16]
ATP probe
 Probe Info  		N.A.  LDD0035  [17]
IPM
 Probe Info  		C284(0.00); C13(0.00)  LDD0025  [18]
TFBX
 Probe Info  		N.A.  LDD0027  [18]
1d-yne
 Probe Info  		K191(0.00); K104(0.00)  LDD0356  [19]
ENE
 Probe Info  		N.A.  LDD0006  [20]
NHS
 Probe Info  		K191(0.00); K171(0.00); K313(0.00)  LDD0010  [20]
SF
 Probe Info  		Y109(0.00); Y200(0.00); Y26(0.00)  LDD0028  [21]
VSF
 Probe Info  		N.A.  LDD0007  [20]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [22]
1c-yne
 Probe Info  		K171(0.00); K182(0.00); K55(0.00); K191(0.00)  LDD0228  [19]
Crotonaldehyde
 Probe Info  		H213(0.00); H212(0.00); H170(0.00)  LDD0219  [12]
AOyne
 Probe Info  		15.00  LDD0443  [23]
MPP-AC
 Probe Info  		N.A.  LDD0428  [24]
NAIA_5
 Probe Info  		N.A.  LDD2223  [25]
TER-AC
 Probe Info  		N.A.  LDD0426  [24]
PAL-AfBPP Probe
Click To Hide/Show 9 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
FFF probe11
 Probe Info  		7.13  LDD0472  [26]
FFF probe13
 Probe Info  		12.72  LDD0475  [26]
FFF probe2
 Probe Info  		6.06  LDD0463  [26]
FFF probe3
 Probe Info  		5.28  LDD0464  [26]
FFF probe4
 Probe Info  		7.79  LDD0466  [26]
STS-2
 Probe Info  		1.53  LDD0139  [27]
VE-P
 Probe Info  		N.A.  LDD0396  [28]
DA-2
 Probe Info  		N.A.  LDD0070  [29]
OEA-DA
 Probe Info  		3.74  LDD0046  [30]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0548  1-(4-(Benzo[d][1,3]dioxol-5-ylmethyl)piperazin-1-yl)-2-nitroethan-1-one MDA-MB-231 C284(0.50)  LDD2142  [8]
 LDCM0519  1-(6-methoxy-3,4-dihydroquinolin-1(2H)-yl)-2-nitroethan-1-one MDA-MB-231 C284(0.71)  LDD2112  [8]
 LDCM0502  1-(Cyanoacetyl)piperidine MDA-MB-231 C284(0.58)  LDD2095  [8]
 LDCM0537  2-Cyano-N,N-dimethylacetamide MDA-MB-231 C284(0.85)  LDD2130  [8]
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C284(0.69)  LDD2117  [8]
 LDCM0558  2-Cyano-N-phenylacetamide MDA-MB-231 C284(1.21)  LDD2152  [8]
 LDCM0539  3-(4-Isopropylpiperazin-1-yl)-3-oxopropanenitrile MDA-MB-231 C284(0.45)  LDD2132  [8]
 LDCM0538  4-(Cyanoacetyl)morpholine MDA-MB-231 C284(0.60)  LDD2131  [8]
 LDCM0545  Acetamide MDA-MB-231 C284(0.25)  LDD2138  [8]
 LDCM0156  Aniline NCI-H1299 12.65  LDD0403  [1]
 LDCM0498  BS-3668 MDA-MB-231 C284(0.34)  LDD2091  [8]
 LDCM0108  Chloroacetamide HeLa H213(0.00); H212(0.00)  LDD0222  [12]
 LDCM0632  CL-Sc Hep-G2 C284(2.82); C13(1.61); C13(1.26)  LDD2227  [25]
 LDCM0634  CY-0357 Hep-G2 C13(0.86)  LDD2228  [25]
 LDCM0175  Ethacrynic acid HeLa N.A.  LDD0440  [9]
 LDCM0107  IAA HeLa H213(0.00); H212(0.00)  LDD0221  [12]
 LDCM0129  JWB202 DM93 Y200(0.16)  LDD0291  [10]
 LDCM0509  N-(4-bromo-3,5-dimethylphenyl)-2-nitroacetamide MDA-MB-231 C284(1.14)  LDD2102  [8]
 LDCM0109  NEM HeLa H201(0.00); H213(0.00); H212(0.00)  LDD0223  [12]
 LDCM0496  Nucleophilic fragment 11a MDA-MB-231 C284(0.43)  LDD2089  [8]
 LDCM0497  Nucleophilic fragment 11b MDA-MB-231 C284(0.92)  LDD2090  [8]
 LDCM0499  Nucleophilic fragment 12b MDA-MB-231 C284(1.12)  LDD2092  [8]
 LDCM0500  Nucleophilic fragment 13a MDA-MB-231 C284(0.95)  LDD2093  [8]
 LDCM0501  Nucleophilic fragment 13b MDA-MB-231 C284(1.58)  LDD2094  [8]
 LDCM0503  Nucleophilic fragment 14b MDA-MB-231 C284(0.38)  LDD2096  [8]
 LDCM0504  Nucleophilic fragment 15a MDA-MB-231 C284(0.56)  LDD2097  [8]
 LDCM0505  Nucleophilic fragment 15b MDA-MB-231 C284(0.78)  LDD2098  [8]
 LDCM0506  Nucleophilic fragment 16a MDA-MB-231 C284(0.62)  LDD2099  [8]
 LDCM0507  Nucleophilic fragment 16b MDA-MB-231 C284(0.48)  LDD2100  [8]
 LDCM0508  Nucleophilic fragment 17a MDA-MB-231 C284(0.94)  LDD2101  [8]
 LDCM0511  Nucleophilic fragment 18b MDA-MB-231 C284(0.53)  LDD2104  [8]
 LDCM0512  Nucleophilic fragment 19a MDA-MB-231 C284(1.84)  LDD2105  [8]
 LDCM0513  Nucleophilic fragment 19b MDA-MB-231 C284(0.34)  LDD2106  [8]
 LDCM0514  Nucleophilic fragment 20a MDA-MB-231 C284(0.78)  LDD2107  [8]
 LDCM0515  Nucleophilic fragment 20b MDA-MB-231 C284(0.64)  LDD2108  [8]
 LDCM0517  Nucleophilic fragment 21b MDA-MB-231 C284(0.94)  LDD2110  [8]
 LDCM0518  Nucleophilic fragment 22a MDA-MB-231 C284(0.72)  LDD2111  [8]
 LDCM0521  Nucleophilic fragment 23b MDA-MB-231 C284(0.53)  LDD2114  [8]
 LDCM0523  Nucleophilic fragment 24b MDA-MB-231 C284(0.62)  LDD2116  [8]
 LDCM0525  Nucleophilic fragment 25b MDA-MB-231 C284(0.57)  LDD2118  [8]
 LDCM0526  Nucleophilic fragment 26a MDA-MB-231 C284(2.74)  LDD2119  [8]
 LDCM0529  Nucleophilic fragment 27b MDA-MB-231 C284(0.49)  LDD2122  [8]
 LDCM0531  Nucleophilic fragment 28b MDA-MB-231 C284(0.53)  LDD2124  [8]
 LDCM0532  Nucleophilic fragment 29a MDA-MB-231 C284(0.57)  LDD2125  [8]
 LDCM0533  Nucleophilic fragment 29b MDA-MB-231 C284(1.16)  LDD2126  [8]
 LDCM0536  Nucleophilic fragment 31 MDA-MB-231 C284(0.99)  LDD2129  [8]
 LDCM0542  Nucleophilic fragment 37 MDA-MB-231 C284(0.97)  LDD2135  [8]
 LDCM0543  Nucleophilic fragment 38 MDA-MB-231 C284(0.83)  LDD2136  [8]
 LDCM0211  Nucleophilic fragment 3b MDA-MB-231 C284(1.30)  LDD1700  [8]
 LDCM0547  Nucleophilic fragment 41 MDA-MB-231 C284(0.42)  LDD2141  [8]
 LDCM0550  Nucleophilic fragment 5a MDA-MB-231 C284(3.02)  LDD2144  [8]
 LDCM0552  Nucleophilic fragment 6a MDA-MB-231 C284(0.63)  LDD2146  [8]
 LDCM0554  Nucleophilic fragment 7a MDA-MB-231 C284(0.65)  LDD2148  [8]
 LDCM0555  Nucleophilic fragment 7b MDA-MB-231 C284(0.75)  LDD2149  [8]
 LDCM0557  Nucleophilic fragment 8b MDA-MB-231 C284(0.65)  LDD2151  [8]
 LDCM0627  NUDT7-COV-1 HEK-293T C13(1.20)  LDD2206  [31]
 LDCM0628  OTUB2-COV-1 HEK-293T C13(0.71)  LDD2207  [31]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Syntenin-1 (SDCBP) . O00560
Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ataxin-1 (ATXN1) ATXN1 family P54253
Polyubiquitin-C (UBC) Ubiquitin family P0CG48
TAR DNA-binding protein 43 (TARDBP) . Q13148

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 2-Ethynylbenzaldehyde-Based, Lysine-Targeting Irreversible Covalent Inhibitors for Protein Kinases and Nonkinases. J Am Chem Soc. 2023 Feb 12. doi: 10.1021/jacs.2c11595. Online ahead of print.
Mass spectrometry data entry: PXD037665
3 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.
4 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
5 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
6 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
7 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
8 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
9 Chemoproteomic Profiling Reveals Ethacrynic Acid Targets Adenine Nucleotide Translocases to Impair Mitochondrial Function. Mol Pharm. 2018 Jun 4;15(6):2413-2422. doi: 10.1021/acs.molpharmaceut.8b00250. Epub 2018 May 15.
10 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
11 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
12 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
13 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
14 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
15 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
16 SP3-Enabled Rapid and High Coverage Chemoproteomic Identification of Cell-State-Dependent Redox-Sensitive Cysteines. Mol Cell Proteomics. 2022 Apr;21(4):100218. doi: 10.1016/j.mcpro.2022.100218. Epub 2022 Feb 25.
Mass spectrometry data entry: PXD029500 , PXD031647
17 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
18 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
19 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
20 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
21 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
22 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
23 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
24 Differently Tagged Probes for Protein Profiling of Mitochondria. Chembiochem. 2019 May 2;20(9):1155-1160. doi: 10.1002/cbic.201800735. Epub 2019 Mar 26.
25 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
26 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
27 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.
28 Pharmacological Targeting of Vacuolar H(+)-ATPase via Subunit V1G Combats Multidrug-Resistant Cancer. Cell Chem Biol. 2020 Nov 19;27(11):1359-1370.e8. doi: 10.1016/j.chembiol.2020.06.011. Epub 2020 Jul 9.
29 Cell-based proteome profiling of potential dasatinib targets by use of affinity-based probes. J Am Chem Soc. 2012 Feb 15;134(6):3001-14. doi: 10.1021/ja208518u. Epub 2012 Feb 1.
30 Mapping Protein Targets of Bioactive Small Molecules Using Lipid-Based Chemical Proteomics. ACS Chem Biol. 2017 Oct 20;12(10):2671-2681. doi: 10.1021/acschembio.7b00581. Epub 2017 Sep 20.
Mass spectrometry data entry: PXD007570
31 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.