Details of the Target
General Information of Target
Target ID | LDTP04979 | |||||
---|---|---|---|---|---|---|
Target Name | U6 snRNA-associated Sm-like protein LSm3 (LSM3) | |||||
Gene Name | LSM3 | |||||
Gene ID | 27258 | |||||
Synonyms |
U6 snRNA-associated Sm-like protein LSm3 |
|||||
3D Structure | ||||||
Sequence |
MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEET
VTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG |
|||||
Target Bioclass |
Other
|
|||||
Family |
SnRNP Sm proteins family
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C-Sul Probe Info |
![]() |
3.16 | LDD0066 | [1] | |
TH211 Probe Info |
![]() |
Y46(20.00) | LDD0257 | [2] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C063 Probe Info |
![]() |
10.93 | LDD1760 | [3] | |
C091 Probe Info |
![]() |
10.20 | LDD1782 | [3] | |
C173 Probe Info |
![]() |
5.58 | LDD1853 | [3] | |
C177 Probe Info |
![]() |
10.70 | LDD1856 | [3] | |
C287 Probe Info |
![]() |
11.55 | LDD1957 | [3] | |
C293 Probe Info |
![]() |
19.84 | LDD1963 | [3] | |
C310 Probe Info |
![]() |
10.34 | LDD1977 | [3] | |
C313 Probe Info |
![]() |
25.28 | LDD1980 | [3] | |
C361 Probe Info |
![]() |
17.63 | LDD2022 | [3] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Methylosome subunit pICln (CLNS1A) | PICln (TC 1.A.47) family | P54105 | |||
AP-4 complex accessory subunit Tepsin (TEPSIN) | . | Q96N21 |
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Y-box-binding protein 1 (YBX1) | YBX1 family | P67809 | |||
Nucleus accumbens-associated protein 1 (NACC1) | . | Q96RE7 |
Other
References