Details of the Target

General Information of Target

Target ID LDTP13664
Target Name Syntaxin-8 (STX8)
Gene Name STX8
Gene ID 9482
Synonyms
Syntaxin-8
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLEAPGPSDGCELSNPSASRVSCAGQMLEVQPGLYFGGAAAVAEPDHLREAGITAVLTVD
SEEPSFKAGPGVEDLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVS
RSVAIITAFLMKTDQLPFEKAYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYK
QYRLQKVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREG
SGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSF
NWYGEQCSCGRWITPAFQIHKNRVDEMKILPVLGSQTGKI
Target Bioclass
Other
Family
Syntaxin family
Subcellular location
Membrane
Function Vesicle trafficking protein that functions in the early secretory pathway, possibly by mediating retrograde transport from cis-Golgi membranes to the ER.
Uniprot ID
Q9UNK0
Ensemble ID
ENST00000306357.9
HGNC ID
HGNC:11443

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 11 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
CHEMBL5175495
 Probe Info  		7.75  LDD0196  [1]
TG42
 Probe Info  		7.85  LDD0043  [2]
STPyne
 Probe Info  		K98(10.00)  LDD0277  [3]
DBIA
 Probe Info  		C14(0.98)  LDD3332  [4]
Johansson_61
 Probe Info  		_(13.09)  LDD1487  [5]
Alkyne-RA190
 Probe Info  		3.29  LDD0302  [6]
5E-2FA
 Probe Info  		N.A.  LDD2235  [7]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [8]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [8]
IPM
 Probe Info  		N.A.  LDD2156  [9]
AOyne
 Probe Info  		7.80  LDD0443  [10]
PAL-AfBPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C134
 Probe Info  		24.25  LDD1816  [11]
C135
 Probe Info  		10.34  LDD1817  [11]
C170
 Probe Info  		7.94  LDD1850  [11]
C231
 Probe Info  		12.73  LDD1904  [11]
C235
 Probe Info  		18.64  LDD1908  [11]
C310
 Probe Info  		8.94  LDD1977  [11]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0615  Fragment63-R Jurkat _(13.09)  LDD1487  [5]
 LDCM0617  Fragment63-S Jurkat _(14.30)  LDD1490  [5]
 LDCM0022  KB02 A673 C14(0.80)  LDD2261  [4]
 LDCM0023  KB03 42-MG-BA C14(1.03)  LDD2661  [4]
 LDCM0024  KB05 MKN45 C14(0.98)  LDD3332  [4]
 LDCM0131  RA190 SK-MEL-5 3.29  LDD0302  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
Probable glutathione peroxidase 8 (GPX8) Glutathione peroxidase family Q8TED1
Sphingosine-1-phosphate lyase 1 (SGPL1) Group II decarboxylase family O95470
Glutathione S-transferase 3, mitochondrial (MGST3) MAPEG family O14880
Microsomal glutathione S-transferase 2 (MGST2) MAPEG family Q99735
Transmembrane protein with metallophosphoesterase domain (TMPPE) LOC643853 family Q6ZT21
Methylmalonyl-CoA epimerase, mitochondrial (MCEE) Methylmalonyl-CoA epimerase family Q96PE7
Ribonuclease kappa (RNASEK) RNase K family Q6P5S7
GTP-binding protein SAR1a (SAR1A) SAR1 family Q9NR31
Lysoplasmalogenase TMEM86B (TMEM86B) TMEM86 family Q8N661
Ceramide synthase 4 (CERS4) . Q9HA82
Peptidyl-prolyl cis-trans isomerase FKBP7 (FKBP7) . Q9Y680
Transporter and channel
Click To Hide/Show 16 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Sodium-dependent organic anion transporter (SLC10A6) Bile acid:sodium symporter (BASS) family Q3KNW5
Gap junction alpha-8 protein (GJA8) Connexin family P48165
Gap junction beta-1 protein (GJB1) Connexin family P08034
ER membrane protein complex subunit 5 (MMGT1) Membrane magnesium transporter (TC 1.A.67) family Q8N4V1
Membrane-spanning 4-domains subfamily A member 3 (MS4A3) MS4A family Q96HJ5
Peroxisome assembly protein 12 (PEX12) Pex2/pex10/pex12 family O00623
Sodium channel regulatory subunit beta-3 (SCN3B) Sodium channel auxiliary subunit SCN3B family Q9NY72
Syntaxin-1A (STX1A) Syntaxin family Q16623
Syntaxin-4 (STX4) Syntaxin family Q12846
Syntaxin-5 (STX5) Syntaxin family Q13190
Tetraspanin-12 (TSPAN12) Tetraspanin (TM4SF) family O95859
Transmembrane protein 14B (TMEM14B) TMEM14 family Q9NUH8
Transmembrane protein 179B (TMEM179B) TMEM179 family Q7Z7N9
Transmembrane protein 205 (TMEM205) TMEM205 family Q6UW68
Vesicle transport through interaction with t-SNAREs homolog 1B (VTI1B) VTI1 family Q9UEU0
Barttin (BSND) . Q8WZ55
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) BZIP family Q96BA8
GPCR
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Free fatty acid receptor 2 (FFAR2) G-protein coupled receptor 1 family O15552
G-protein coupled receptor 151 (GPR151) G-protein coupled receptor 1 family Q8TDV0
G-protein coupled receptor 42 (GPR42) G-protein coupled receptor 1 family O15529
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
Immunoglobulin
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CMRF35-like molecule 2 (CD300E) CD300 family Q496F6
Amphoterin-induced protein 1 (AMIGO1) AMIGO family Q86WK6
B-cell antigen receptor complex-associated protein alpha chain (CD79A) . P11912
Natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1) . Q68D85
Other
Click To Hide/Show 20 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Bcl-2-like protein 13 (BCL2L13) Bcl-2 family Q9BXK5
Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1) Bcl-2 family Q07820
Complex I intermediate-associated protein 30, mitochondrial (NDUFAF1) CIA30 family Q9Y375
Claudin-9 (CLDN9) Claudin family O95484
NADH dehydrogenase 1 alpha subcomplex assembly factor 2 (NDUFAF2) Complex I NDUFA12 subunit family Q8N183
Complexin-4 (CPLX4) Complexin/synaphin family Q7Z7G2
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Membrane protein FAM174A (FAM174A) FAM174 family Q8TBP5
Protein FAM209A (FAM209A) FAM209 family Q5JX71
RAB6-interacting golgin (GORAB) GORAB family Q5T7V8
Protein jagunal homolog 1 (JAGN1) Jagunal family Q8N5M9
Transcription termination factor 3, mitochondrial (MTERF3) MTERF family Q96E29
Reticulophagy regulator 3 (RETREG3) RETREG family Q86VR2
Vesicle-associated membrane protein 5 (VAMP5) Synaptobrevin family O95183
Bcl-2-interacting killer (BIK) . Q13323
Fibronectin type III domain-containing protein 9 (FNDC9) . Q8TBE3
Junctional sarcoplasmic reticulum protein 1 (JSRP1) . Q96MG2
Protein TMED8 (TMED8) . Q6PL24
Serine-rich single-pass membrane protein 1 (SSMEM1) . Q8WWF3
Steroidogenic acute regulatory protein, mitochondrial (STAR) . P49675

References

1 Charting the Chemical Space of Acrylamide-Based Inhibitors of zDHHC20. ACS Med Chem Lett. 2022 Sep 26;13(10):1648-1654. doi: 10.1021/acsmedchemlett.2c00336. eCollection 2022 Oct 13.
2 Design and synthesis of tailored human caseinolytic protease P inhibitors. Chem Commun (Camb). 2018 Aug 28;54(70):9833-9836. doi: 10.1039/c8cc05265d.
Mass spectrometry data entry: PXD010277
3 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
4 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
5 Proteome-wide covalent ligand discovery in native biological systems. Nature. 2016 Jun 23;534(7608):570-4. doi: 10.1038/nature18002. Epub 2016 Jun 15.
6 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.
7 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
8 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
9 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
10 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
11 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587