General Information of Target

Target ID LDTP13136
Target Name Histone deacetylase 6 (HDAC6)
Gene Name HDAC6
Gene ID 10013
Synonyms
KIAA0901; Histone deacetylase 6; HD6; EC 3.5.1.98; Protein deacetylase HDAC6; EC 3.5.1.-; Tubulin-lysine deacetylase HDAC6; EC 3.5.1.-
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGLWGQSVPTASSARAGRYPGARTASGTRPWLLDPKILKFVVFIVAVLLPVRVDSATIPR
QDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTV
CKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKC
KNESAASSTGKTPAAEETVTTILGMLASPYHYLIIIVVLVIILAVVVVGFSCRKKFISYL
KGICSGGGGGPERVHRVLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQEL
AELTGVTVELPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKE
TIQDQLVGSEKLFYEEDEAGSATSCL
Target Type
Clinical trial
Target Bioclass
Enzyme
Family
Histone deacetylase family, HD type 2 subfamily
Subcellular location
Cytoplasm
Function
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. In addition to histones, deacetylates other proteins, such as CTTN, tubulin and SQSTM1. Plays a central role in microtubule-dependent cell motility by mediating deacetylation of tubulin. Required for cilia disassembly; via deacetylation of alpha-tubulin. Promotes deacetylation of CTTN, leading to actin polymerization, promotion of autophagosome-lysosome fusion and completion of autophagy. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer. Promotes odontoblast differentiation following IPO7-mediated nuclear import and subsequent repression of RUNX2 expression. In addition to its protein deacetylase activity, plays a key role in the degradation of misfolded proteins: when misfolded proteins are too abundant to be degraded by the chaperone refolding system and the ubiquitin-proteasome, mediates the transport of misfolded proteins to a cytoplasmic juxtanuclear structure called aggresome. Probably acts as an adapter that recognizes polyubiquitinated misfolded proteins and target them to the aggresome, facilitating their clearance by autophagy.
TTD ID
T22274
Uniprot ID
Q9UBN7
DrugMap ID
TT5ZKDI
Ensemble ID
ENST00000334136.11
HGNC ID
HGNC:14064
ChEMBL ID
CHEMBL1865

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CCK81 SNV: p.L119P DBIA    Probe Info 
COLO679 SNV: p.G696S DBIA    Probe Info 
EFO27 SNV: p.A612T DBIA    Probe Info 
HUH7 SNV: p.R529P DBIA    Probe Info 
IGR1 SNV: p.A357V DBIA    Probe Info 
MCC13 SNV: p.S625F
Substitution: p.R389C
DBIA    Probe Info 
NALM6 SNV: p.S563T DBIA    Probe Info 
NCIH2286 SNV: p.R549P DBIA    Probe Info 
SKOV3 SNV: p.Q258Ter DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 13 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info 
Y715(6.66)  LDD0257  [1]
STPyne
 Probe Info 
K116(1.25)  LDD0277  [2]
SAHA-CA-4PAP
 Probe Info 
20.00  LDD0269  [3]
AHL-Pu-1
 Probe Info 
C426(6.16)  LDD0170  [4]
IPM
 Probe Info 
C523(5.71)  LDD1701  [5]
DBIA
 Probe Info 
C572(1.81); C578(1.81)  LDD0080  [6]
4-Iodoacetamidophenylacetylene
 Probe Info 
C523(0.00); C752(0.00); C128(0.00); C426(0.00)  LDD0038  [7]
IA-alkyne
 Probe Info 
C407(0.00); C417(0.00); C128(0.00); C752(0.00)  LDD0036  [7]
Lodoacetamide azide
 Probe Info 
C128(0.00); C752(0.00); C539(0.00); C426(0.00)  LDD0037  [7]
NAIA_4
 Probe Info 
N.A.  LDD2226  [8]
TFBX
 Probe Info 
N.A.  LDD0027  [9]
AOyne
 Probe Info 
11.80  LDD0443  [10]
NAIA_5
 Probe Info 
C426(0.00); C539(0.00); C523(0.00)  LDD2223  [8]
PAL-AfBPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
SAHA-CA-3PAP
 Probe Info 
N.A.  LDD0363  [3]
SAHA-CA-8PAP
 Probe Info 
37.20  LDD0362  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0025  4SU-RNA DM93 C426(6.16)  LDD0170  [4]
 LDCM0214  AC1 HCT 116 C523(0.88)  LDD0531  [6]
 LDCM0215  AC10 HCT 116 C572(0.78); C578(0.78)  LDD0532  [6]
 LDCM0216  AC100 PaTu 8988t C587(1.31); C572(1.31); C578(1.31)  LDD1095  [6]
 LDCM0217  AC101 PaTu 8988t C587(1.13); C572(1.13); C578(1.13)  LDD1096  [6]
 LDCM0218  AC102 PaTu 8988t C587(0.93); C572(0.93); C578(0.93)  LDD1097  [6]
 LDCM0219  AC103 PaTu 8988t C587(1.19); C572(1.19); C578(1.19)  LDD1098  [6]
 LDCM0220  AC104 PaTu 8988t C587(1.43); C572(1.43); C578(1.43)  LDD1099  [6]
 LDCM0221  AC105 PaTu 8988t C587(0.92); C572(0.92); C578(0.92)  LDD1100  [6]
 LDCM0222  AC106 PaTu 8988t C587(1.03); C572(1.03); C578(1.03)  LDD1101  [6]
 LDCM0223  AC107 PaTu 8988t C587(1.62); C572(1.62); C578(1.62)  LDD1102  [6]
 LDCM0224  AC108 PaTu 8988t C587(1.15); C572(1.15); C578(1.15)  LDD1103  [6]
 LDCM0225  AC109 PaTu 8988t C587(1.03); C572(1.03); C578(1.03)  LDD1104  [6]
 LDCM0226  AC11 HCT 116 C572(0.54); C578(0.54)  LDD0543  [6]
 LDCM0227  AC110 PaTu 8988t C587(1.36); C572(1.36); C578(1.36)  LDD1106  [6]
 LDCM0228  AC111 PaTu 8988t C587(1.01); C572(1.01); C578(1.01)  LDD1107  [6]
 LDCM0229  AC112 PaTu 8988t C587(0.91); C572(0.91); C578(0.91)  LDD1108  [6]
 LDCM0230  AC113 PaTu 8988t C572(0.91); C578(0.91)  LDD1109  [6]
 LDCM0231  AC114 PaTu 8988t C572(0.64); C578(0.64)  LDD1110  [6]
 LDCM0232  AC115 PaTu 8988t C572(0.69); C578(0.69)  LDD1111  [6]
 LDCM0233  AC116 PaTu 8988t C572(0.96); C578(0.96)  LDD1112  [6]
 LDCM0234  AC117 PaTu 8988t C572(0.71); C578(0.71)  LDD1113  [6]
 LDCM0235  AC118 PaTu 8988t C572(1.27); C578(1.27)  LDD1114  [6]
 LDCM0236  AC119 PaTu 8988t C572(0.93); C578(0.93)  LDD1115  [6]
 LDCM0237  AC12 HCT 116 C572(0.52); C578(0.52)  LDD0554  [6]
 LDCM0238  AC120 PaTu 8988t C572(1.01); C578(1.01)  LDD1117  [6]
 LDCM0239  AC121 PaTu 8988t C572(0.79); C578(0.79)  LDD1118  [6]
 LDCM0240  AC122 PaTu 8988t C572(1.94); C578(1.94)  LDD1119  [6]
 LDCM0241  AC123 PaTu 8988t C572(1.09); C578(1.09)  LDD1120  [6]
 LDCM0242  AC124 PaTu 8988t C572(1.31); C578(1.31)  LDD1121  [6]
 LDCM0243  AC125 PaTu 8988t C572(1.52); C578(1.52)  LDD1122  [6]
 LDCM0244  AC126 PaTu 8988t C572(1.08); C578(1.08)  LDD1123  [6]
 LDCM0245  AC127 PaTu 8988t C572(1.12); C578(1.12)  LDD1124  [6]
 LDCM0246  AC128 HEK-293T C523(0.83)  LDD0844  [6]
 LDCM0247  AC129 HEK-293T C523(1.27)  LDD0845  [6]
 LDCM0249  AC130 HEK-293T C523(1.07)  LDD0847  [6]
 LDCM0250  AC131 HEK-293T C523(1.06)  LDD0848  [6]
 LDCM0251  AC132 HEK-293T C523(0.87)  LDD0849  [6]
 LDCM0252  AC133 HEK-293T C523(0.99)  LDD0850  [6]
 LDCM0253  AC134 HEK-293T C523(1.20)  LDD0851  [6]
 LDCM0254  AC135 HEK-293T C523(1.05)  LDD0852  [6]
 LDCM0255  AC136 HEK-293T C523(1.07)  LDD0853  [6]
 LDCM0256  AC137 HEK-293T C523(1.26)  LDD0854  [6]
 LDCM0257  AC138 HEK-293T C523(1.47)  LDD0855  [6]
 LDCM0258  AC139 HEK-293T C523(1.38)  LDD0856  [6]
 LDCM0259  AC14 HCT 116 C572(0.48); C578(0.48)  LDD0576  [6]
 LDCM0260  AC140 HEK-293T C523(1.13)  LDD0858  [6]
 LDCM0261  AC141 HEK-293T C523(1.40)  LDD0859  [6]
 LDCM0262  AC142 HEK-293T C523(1.12)  LDD0860  [6]
 LDCM0263  AC143 PaTu 8988t C587(1.09); C572(0.96); C578(0.82)  LDD1142  [6]
 LDCM0264  AC144 PaTu 8988t C587(0.86); C572(0.84); C578(0.83)  LDD1143  [6]
 LDCM0265  AC145 PaTu 8988t C587(0.88); C572(1.00); C578(1.12)  LDD1144  [6]
 LDCM0266  AC146 PaTu 8988t C587(1.61); C572(1.40); C578(1.18)  LDD1145  [6]
 LDCM0267  AC147 PaTu 8988t C587(1.25); C572(1.07); C578(0.89)  LDD1146  [6]
 LDCM0268  AC148 PaTu 8988t C587(0.80); C572(0.87); C578(0.94)  LDD1147  [6]
 LDCM0269  AC149 PaTu 8988t C587(0.72); C572(0.71); C578(0.70)  LDD1148  [6]
 LDCM0270  AC15 HCT 116 C572(0.55); C578(0.55)  LDD0587  [6]
 LDCM0271  AC150 PaTu 8988t C587(0.94); C572(0.86); C578(0.77)  LDD1150  [6]
 LDCM0272  AC151 PaTu 8988t C587(0.99); C572(0.92); C578(0.84)  LDD1151  [6]
 LDCM0273  AC152 PaTu 8988t C587(0.75); C572(0.69); C578(0.64)  LDD1152  [6]
 LDCM0274  AC153 PaTu 8988t C587(0.90); C572(0.86); C578(0.81)  LDD1153  [6]
 LDCM0621  AC154 PaTu 8988t C587(0.81); C572(0.81); C578(0.81)  LDD2166  [6]
 LDCM0622  AC155 PaTu 8988t C587(0.75); C572(0.78); C578(0.80)  LDD2167  [6]
 LDCM0623  AC156 PaTu 8988t C587(0.83); C572(0.77); C578(0.70)  LDD2168  [6]
 LDCM0624  AC157 PaTu 8988t C587(0.80); C572(0.76); C578(0.72)  LDD2169  [6]
 LDCM0276  AC17 HCT 116 C128(1.12)  LDD0593  [6]
 LDCM0277  AC18 HCT 116 C128(0.56)  LDD0594  [6]
 LDCM0278  AC19 HCT 116 C128(0.95)  LDD0595  [6]
 LDCM0279  AC2 HCT 116 C523(0.71)  LDD0596  [6]
 LDCM0280  AC20 HCT 116 C128(1.19)  LDD0597  [6]
 LDCM0281  AC21 HCT 116 C128(0.99)  LDD0598  [6]
 LDCM0282  AC22 HCT 116 C128(1.28)  LDD0599  [6]
 LDCM0283  AC23 HCT 116 C128(1.24)  LDD0600  [6]
 LDCM0284  AC24 HCT 116 C128(1.07)  LDD0601  [6]
 LDCM0285  AC25 HCT 116 C128(0.88)  LDD0602  [6]
 LDCM0286  AC26 HCT 116 C128(0.65)  LDD0603  [6]
 LDCM0287  AC27 HCT 116 C128(0.86)  LDD0604  [6]
 LDCM0288  AC28 HCT 116 C128(0.64)  LDD0605  [6]
 LDCM0289  AC29 HCT 116 C128(0.82)  LDD0606  [6]
 LDCM0290  AC3 HCT 116 C523(1.02)  LDD0607  [6]
 LDCM0291  AC30 HCT 116 C128(0.75)  LDD0608  [6]
 LDCM0292  AC31 HCT 116 C128(0.74)  LDD0609  [6]
 LDCM0293  AC32 HCT 116 C128(0.70)  LDD0610  [6]
 LDCM0294  AC33 HCT 116 C128(0.93)  LDD0611  [6]
 LDCM0295  AC34 HCT 116 C128(0.68)  LDD0612  [6]
 LDCM0296  AC35 HCT 116 C572(1.21); C587(1.21)  LDD0613  [6]
 LDCM0297  AC36 HCT 116 C572(1.26); C587(1.26)  LDD0614  [6]
 LDCM0298  AC37 HCT 116 C572(0.71); C587(0.71)  LDD0615  [6]
 LDCM0299  AC38 HCT 116 C572(1.64); C587(1.64)  LDD0616  [6]
 LDCM0300  AC39 HCT 116 C572(0.67); C587(0.67)  LDD0617  [6]
 LDCM0301  AC4 HCT 116 C523(0.95)  LDD0618  [6]
 LDCM0302  AC40 HCT 116 C572(0.98); C587(0.98)  LDD0619  [6]
 LDCM0303  AC41 HCT 116 C572(0.63); C587(0.63)  LDD0620  [6]
 LDCM0304  AC42 HCT 116 C572(1.08); C587(1.08)  LDD0621  [6]
 LDCM0305  AC43 HCT 116 C572(0.90); C587(0.90)  LDD0622  [6]
 LDCM0306  AC44 HCT 116 C572(0.75); C587(0.75)  LDD0623  [6]
 LDCM0307  AC45 HCT 116 C572(0.75); C587(0.75)  LDD0624  [6]
 LDCM0308  AC46 HCT 116 C128(0.81); C572(1.59); C587(1.59)  LDD0625  [6]
 LDCM0309  AC47 HCT 116 C572(0.84); C587(0.84); C128(0.87)  LDD0626  [6]
 LDCM0310  AC48 HCT 116 C572(1.02); C587(1.02); C128(1.10)  LDD0627  [6]
 LDCM0311  AC49 HCT 116 C128(0.76); C572(1.05); C587(1.05)  LDD0628  [6]
 LDCM0312  AC5 HCT 116 C523(0.96)  LDD0629  [6]
 LDCM0313  AC50 HCT 116 C128(0.72); C572(1.07); C587(1.07)  LDD0630  [6]
 LDCM0314  AC51 HCT 116 C572(0.88); C587(0.88); C128(1.15)  LDD0631  [6]
 LDCM0315  AC52 HCT 116 C128(0.83); C572(1.37); C587(1.37)  LDD0632  [6]
 LDCM0316  AC53 HCT 116 C128(0.75); C572(1.01); C587(1.01)  LDD0633  [6]
 LDCM0317  AC54 HCT 116 C128(0.73); C572(1.01); C587(1.01)  LDD0634  [6]
 LDCM0318  AC55 HCT 116 C128(0.80); C572(1.15); C587(1.15)  LDD0635  [6]
 LDCM0319  AC56 HCT 116 C128(0.82); C572(1.22); C587(1.22)  LDD0636  [6]
 LDCM0320  AC57 HCT 116 C572(0.57); C587(0.57); C128(0.84); C523(1.03)  LDD0637  [6]
 LDCM0321  AC58 HCT 116 C572(0.67); C587(0.67); C523(0.73); C128(0.87)  LDD0638  [6]
 LDCM0322  AC59 HCT 116 C572(0.52); C587(0.52); C128(0.72); C523(0.94)  LDD0639  [6]
 LDCM0323  AC6 HCT 116 C572(0.38); C578(0.38)  LDD0640  [6]
 LDCM0324  AC60 HCT 116 C523(0.56); C572(0.75); C587(0.75); C128(0.92)  LDD0641  [6]
 LDCM0325  AC61 HCT 116 C572(0.54); C587(0.54); C523(0.75); C128(0.95)  LDD0642  [6]
 LDCM0326  AC62 HCT 116 C572(0.69); C587(0.69); C523(0.80); C128(0.81)  LDD0643  [6]
 LDCM0327  AC63 HCT 116 C572(0.63); C587(0.63); C523(0.83); C128(0.91)  LDD0644  [6]
 LDCM0328  AC64 HCT 116 C572(0.50); C587(0.50); C128(0.69); C523(0.72)  LDD0645  [6]
 LDCM0329  AC65 HCT 116 C572(0.39); C587(0.39); C523(0.77); C128(1.13)  LDD0646  [6]
 LDCM0330  AC66 HCT 116 C572(0.52); C587(0.52); C523(0.82); C128(1.17)  LDD0647  [6]
 LDCM0331  AC67 HCT 116 C572(0.33); C587(0.33); C523(0.74); C128(0.81)  LDD0648  [6]
 LDCM0332  AC68 HEK-293T C523(1.11)  LDD0930  [6]
 LDCM0333  AC69 HEK-293T C523(1.15)  LDD0931  [6]
 LDCM0334  AC7 HCT 116 C572(0.40); C578(0.40)  LDD0651  [6]
 LDCM0335  AC70 HEK-293T C523(1.27)  LDD0933  [6]
 LDCM0336  AC71 HEK-293T C523(1.40)  LDD0934  [6]
 LDCM0337  AC72 HEK-293T C523(1.14)  LDD0935  [6]
 LDCM0338  AC73 HEK-293T C523(1.14)  LDD0936  [6]
 LDCM0339  AC74 HEK-293T C523(1.33)  LDD0937  [6]
 LDCM0340  AC75 HEK-293T C523(1.27)  LDD0938  [6]
 LDCM0341  AC76 HEK-293T C523(1.01)  LDD0939  [6]
 LDCM0342  AC77 HEK-293T C523(1.43)  LDD0940  [6]
 LDCM0343  AC78 HEK-293T C523(1.25)  LDD0941  [6]
 LDCM0344  AC79 HEK-293T C523(1.63)  LDD0942  [6]
 LDCM0345  AC8 HCT 116 C572(0.46); C578(0.46)  LDD0662  [6]
 LDCM0346  AC80 HEK-293T C523(1.49)  LDD0944  [6]
 LDCM0347  AC81 HEK-293T C523(1.23)  LDD0945  [6]
 LDCM0348  AC82 HEK-293T C523(2.11)  LDD0946  [6]
 LDCM0349  AC83 HEK-293T C523(0.87)  LDD0947  [6]
 LDCM0350  AC84 HEK-293T C523(1.33)  LDD0948  [6]
 LDCM0351  AC85 HEK-293T C523(0.96)  LDD0949  [6]
 LDCM0352  AC86 HEK-293T C523(1.07)  LDD0950  [6]
 LDCM0353  AC87 HEK-293T C523(1.00)  LDD0951  [6]
 LDCM0354  AC88 HEK-293T C523(1.16)  LDD0952  [6]
 LDCM0355  AC89 HEK-293T C523(1.02)  LDD0953  [6]
 LDCM0357  AC90 HEK-293T C523(1.52)  LDD0955  [6]
 LDCM0358  AC91 HEK-293T C523(0.98)  LDD0956  [6]
 LDCM0359  AC92 HEK-293T C523(1.16)  LDD0957  [6]
 LDCM0360  AC93 HEK-293T C523(1.03)  LDD0958  [6]
 LDCM0361  AC94 HEK-293T C523(0.89)  LDD0959  [6]
 LDCM0362  AC95 HEK-293T C523(1.16)  LDD0960  [6]
 LDCM0363  AC96 HEK-293T C523(1.44)  LDD0961  [6]
 LDCM0364  AC97 HEK-293T C523(2.14)  LDD0962  [6]
 LDCM0365  AC98 PaTu 8988t C587(1.18); C572(1.18); C578(1.18)  LDD1244  [6]
 LDCM0366  AC99 PaTu 8988t C587(0.95); C572(0.95); C578(0.95)  LDD1245  [6]
 LDCM0248  AKOS034007472 HCT 116 C572(0.35); C578(0.35)  LDD0565  [6]
 LDCM0356  AKOS034007680 HCT 116 C572(0.55); C578(0.55)  LDD0673  [6]
 LDCM0275  AKOS034007705 HCT 116 C572(0.75); C578(0.75)  LDD0592  [6]
 LDCM0020  ARS-1620 HCC44 C572(1.06); C578(1.06)  LDD2171  [6]
 LDCM0367  CL1 HCT 116 C523(0.97); C572(1.86); C578(1.86); C587(1.86)  LDD0684  [6]
 LDCM0368  CL10 HCT 116 C523(1.64); C572(3.29); C578(3.29); C587(3.29)  LDD0685  [6]
 LDCM0369  CL100 HCT 116 C523(1.00)  LDD0686  [6]
 LDCM0370  CL101 HCT 116 C572(0.51); C578(0.51)  LDD0687  [6]
 LDCM0371  CL102 HCT 116 C572(0.39); C578(0.39)  LDD0688  [6]
 LDCM0372  CL103 HCT 116 C572(0.43); C578(0.43)  LDD0689  [6]
 LDCM0373  CL104 HCT 116 C572(0.74); C578(0.74)  LDD0690  [6]
 LDCM0374  CL105 HCT 116 C128(0.78)  LDD0691  [6]
 LDCM0375  CL106 HCT 116 C128(0.84)  LDD0692  [6]
 LDCM0376  CL107 HCT 116 C128(0.84)  LDD0693  [6]
 LDCM0377  CL108 HCT 116 C128(0.66)  LDD0694  [6]
 LDCM0378  CL109 HCT 116 C128(0.87)  LDD0695  [6]
 LDCM0379  CL11 HCT 116 C572(1.68); C578(1.68); C587(1.68); C523(1.70)  LDD0696  [6]
 LDCM0380  CL110 HCT 116 C128(0.78)  LDD0697  [6]
 LDCM0381  CL111 HCT 116 C128(0.98)  LDD0698  [6]
 LDCM0382  CL112 HCT 116 C128(0.67)  LDD0699  [6]
 LDCM0383  CL113 HCT 116 C128(0.63)  LDD0700  [6]
 LDCM0384  CL114 HCT 116 C128(0.64)  LDD0701  [6]
 LDCM0385  CL115 HCT 116 C128(0.90)  LDD0702  [6]
 LDCM0386  CL116 HCT 116 C128(0.81)  LDD0703  [6]
 LDCM0387  CL117 HCT 116 C572(1.26); C587(1.26)  LDD0704  [6]
 LDCM0388  CL118 HCT 116 C572(0.74); C587(0.74)  LDD0705  [6]
 LDCM0389  CL119 HCT 116 C572(0.95); C587(0.95)  LDD0706  [6]
 LDCM0390  CL12 HCT 116 C572(1.14); C578(1.14); C587(1.14); C523(1.57)  LDD0707  [6]
 LDCM0391  CL120 HCT 116 C572(0.64); C587(0.64)  LDD0708  [6]
 LDCM0392  CL121 HCT 116 C128(0.64); C572(1.13); C587(1.13)  LDD0709  [6]
 LDCM0393  CL122 HCT 116 C128(1.01); C572(1.42); C587(1.42)  LDD0710  [6]
 LDCM0394  CL123 HCT 116 C128(0.81); C572(2.94); C587(2.94)  LDD0711  [6]
 LDCM0395  CL124 HCT 116 C128(0.81); C572(1.17); C587(1.17)  LDD0712  [6]
 LDCM0396  CL125 HCT 116 C572(0.56); C587(0.56); C523(0.80); C128(1.20)  LDD0713  [6]
 LDCM0397  CL126 HCT 116 C523(0.42); C572(0.64); C587(0.64); C128(1.09)  LDD0714  [6]
 LDCM0398  CL127 HCT 116 C523(0.70); C572(0.78); C587(0.78); C128(0.81)  LDD0715  [6]
 LDCM0399  CL128 HCT 116 C523(0.53); C572(0.61); C587(0.61); C128(0.85)  LDD0716  [6]
 LDCM0400  CL13 HCT 116 C523(1.29); C572(1.33); C578(1.33); C587(1.33)  LDD0717  [6]
 LDCM0401  CL14 HCT 116 C523(1.38); C572(1.68); C578(1.68); C587(1.68)  LDD0718  [6]
 LDCM0402  CL15 HCT 116 C523(1.01); C572(1.63); C578(1.63); C587(1.63)  LDD0719  [6]
 LDCM0403  CL16 HCT 116 C572(1.04); C587(1.12); C578(1.17); C523(2.14)  LDD0720  [6]
 LDCM0404  CL17 HCT 116 C523(0.93); C572(1.28); C578(1.39); C587(1.39)  LDD0721  [6]
 LDCM0405  CL18 HCT 116 C523(1.27); C572(1.46); C578(1.47); C587(1.50)  LDD0722  [6]
 LDCM0406  CL19 HCT 116 C572(1.03); C587(1.08); C578(1.14); C523(1.20)  LDD0723  [6]
 LDCM0407  CL2 HCT 116 C523(0.84); C572(1.39); C578(1.39); C587(1.39)  LDD0724  [6]
 LDCM0408  CL20 HCT 116 C572(1.10); C587(1.15); C523(1.17); C578(1.20)  LDD0725  [6]
 LDCM0409  CL21 HCT 116 C523(1.23); C587(1.32); C572(1.48); C578(1.67)  LDD0726  [6]
 LDCM0410  CL22 HCT 116 C572(1.35); C523(1.42); C587(1.43); C578(1.59)  LDD0727  [6]
 LDCM0411  CL23 HCT 116 C578(1.15); C572(1.17); C587(1.23); C523(1.38)  LDD0728  [6]
 LDCM0412  CL24 HCT 116 C572(0.96); C587(1.00); C578(1.02); C523(3.03)  LDD0729  [6]
 LDCM0413  CL25 HCT 116 C523(2.10); C572(0.97); C578(1.11); C587(1.05)  LDD0730  [6]
 LDCM0414  CL26 HCT 116 C523(1.45); C572(0.99); C578(1.05); C587(1.08)  LDD0731  [6]
 LDCM0415  CL27 HCT 116 C523(2.04); C572(1.04); C578(1.16); C587(1.17)  LDD0732  [6]
 LDCM0416  CL28 HCT 116 C523(2.28); C572(1.02); C578(1.11); C587(1.09)  LDD0733  [6]
 LDCM0417  CL29 HCT 116 C523(2.43); C572(0.95); C578(1.09); C587(1.11)  LDD0734  [6]
 LDCM0418  CL3 HCT 116 C523(1.02); C572(1.19); C578(1.19); C587(1.19)  LDD0735  [6]
 LDCM0419  CL30 HCT 116 C523(2.21); C572(0.98); C578(0.98); C587(1.08)  LDD0736  [6]
 LDCM0420  CL31 HEK-293T C578(1.30)  LDD1018  [6]
 LDCM0421  CL32 HEK-293T C578(1.17)  LDD1019  [6]
 LDCM0422  CL33 HEK-293T C578(1.17)  LDD1020  [6]
 LDCM0423  CL34 HEK-293T C578(1.07)  LDD1021  [6]
 LDCM0424  CL35 HEK-293T C578(1.19)  LDD1022  [6]
 LDCM0425  CL36 HEK-293T C578(1.09)  LDD1023  [6]
 LDCM0426  CL37 HEK-293T C578(1.25)  LDD1024  [6]
 LDCM0428  CL39 HEK-293T C578(2.13)  LDD1026  [6]
 LDCM0429  CL4 HCT 116 C523(1.15); C572(1.48); C578(1.48); C587(1.48)  LDD0746  [6]
 LDCM0430  CL40 HEK-293T C578(1.42)  LDD1028  [6]
 LDCM0431  CL41 HEK-293T C578(1.92)  LDD1029  [6]
 LDCM0432  CL42 HEK-293T C578(1.87)  LDD1030  [6]
 LDCM0433  CL43 HEK-293T C578(1.89)  LDD1031  [6]
 LDCM0434  CL44 HEK-293T C578(1.42)  LDD1032  [6]
 LDCM0435  CL45 HEK-293T C578(1.75)  LDD1033  [6]
 LDCM0436  CL46 HEK-293T C578(1.21)  LDD1034  [6]
 LDCM0437  CL47 HEK-293T C578(0.98)  LDD1035  [6]
 LDCM0438  CL48 HEK-293T C578(0.91)  LDD1036  [6]
 LDCM0439  CL49 HEK-293T C578(1.12)  LDD1037  [6]
 LDCM0440  CL5 HCT 116 C523(0.82); C572(1.40); C578(1.40); C587(1.40)  LDD0757  [6]
 LDCM0441  CL50 HEK-293T C578(1.25)  LDD1039  [6]
 LDCM0442  CL51 HEK-293T C578(0.99)  LDD1040  [6]
 LDCM0443  CL52 HEK-293T C578(0.79)  LDD1041  [6]
 LDCM0444  CL53 HEK-293T C578(0.85)  LDD1042  [6]
 LDCM0445  CL54 HEK-293T C578(0.98)  LDD1043  [6]
 LDCM0446  CL55 HEK-293T C578(1.08)  LDD1044  [6]
 LDCM0447  CL56 HEK-293T C578(0.84)  LDD1045  [6]
 LDCM0448  CL57 HEK-293T C578(0.97)  LDD1046  [6]
 LDCM0449  CL58 HEK-293T C578(0.94)  LDD1047  [6]
 LDCM0450  CL59 HEK-293T C578(1.23)  LDD1048  [6]
 LDCM0451  CL6 HCT 116 C523(0.91); C572(1.69); C578(1.69); C587(1.69)  LDD0768  [6]
 LDCM0452  CL60 HEK-293T C578(1.43)  LDD1050  [6]
 LDCM0453  CL61 HCT 116 C572(0.33); C578(0.33)  LDD0770  [6]
 LDCM0454  CL62 HCT 116 C572(0.35); C578(0.35)  LDD0771  [6]
 LDCM0455  CL63 HCT 116 C572(0.23); C578(0.23)  LDD0772  [6]
 LDCM0456  CL64 HCT 116 C572(0.35); C578(0.35)  LDD0773  [6]
 LDCM0457  CL65 HCT 116 C572(0.35); C578(0.35)  LDD0774  [6]
 LDCM0458  CL66 HCT 116 C572(0.31); C578(0.31)  LDD0775  [6]
 LDCM0459  CL67 HCT 116 C572(0.28); C578(0.28)  LDD0776  [6]
 LDCM0460  CL68 HCT 116 C572(0.36); C578(0.36)  LDD0777  [6]
 LDCM0461  CL69 HCT 116 C572(0.73); C578(0.73)  LDD0778  [6]
 LDCM0462  CL7 HCT 116 C523(1.42); C572(1.51); C578(1.51); C587(1.51)  LDD0779  [6]
 LDCM0463  CL70 HCT 116 C572(0.34); C578(0.34)  LDD0780  [6]
 LDCM0464  CL71 HCT 116 C572(0.33); C578(0.33)  LDD0781  [6]
 LDCM0465  CL72 HCT 116 C572(0.19); C578(0.19)  LDD0782  [6]
 LDCM0466  CL73 HCT 116 C572(0.41); C578(0.41)  LDD0783  [6]
 LDCM0467  CL74 HCT 116 C572(0.34); C578(0.34)  LDD0784  [6]
 LDCM0469  CL76 HCT 116 C572(0.76); C578(0.76); C587(0.76)  LDD0786  [6]
 LDCM0470  CL77 HCT 116 C572(2.95); C578(2.95); C587(2.95)  LDD0787  [6]
 LDCM0471  CL78 HCT 116 C572(0.95); C578(0.95); C587(0.95)  LDD0788  [6]
 LDCM0472  CL79 HCT 116 C572(0.96); C578(0.96); C587(0.96)  LDD0789  [6]
 LDCM0473  CL8 HCT 116 C523(0.99); C572(1.39); C578(1.39); C587(1.39)  LDD0790  [6]
 LDCM0474  CL80 HCT 116 C572(0.81); C578(0.81); C587(0.81)  LDD0791  [6]
 LDCM0475  CL81 HCT 116 C572(1.49); C578(1.49); C587(1.49)  LDD0792  [6]
 LDCM0476  CL82 HCT 116 C572(0.98); C578(0.98); C587(0.98)  LDD0793  [6]
 LDCM0477  CL83 HCT 116 C572(0.63); C578(0.63); C587(0.63)  LDD0794  [6]
 LDCM0478  CL84 HCT 116 C572(0.77); C578(0.77); C587(0.77)  LDD0795  [6]
 LDCM0479  CL85 HCT 116 C572(0.99); C578(0.99); C587(0.99)  LDD0796  [6]
 LDCM0480  CL86 HCT 116 C572(0.60); C578(0.60); C587(0.60)  LDD0797  [6]
 LDCM0481  CL87 HCT 116 C572(0.79); C578(0.79); C587(0.79)  LDD0798  [6]
 LDCM0482  CL88 HCT 116 C572(0.68); C578(0.68); C587(0.68)  LDD0799  [6]
 LDCM0483  CL89 HCT 116 C572(1.05); C578(1.05); C587(1.05)  LDD0800  [6]
 LDCM0484  CL9 HCT 116 C523(1.31); C572(1.29); C578(1.29); C587(1.29)  LDD0801  [6]
 LDCM0485  CL90 HCT 116 C572(1.19); C578(1.19); C587(1.19)  LDD0802  [6]
 LDCM0486  CL91 HCT 116 C523(0.63)  LDD0803  [6]
 LDCM0487  CL92 HCT 116 C523(0.71)  LDD0804  [6]
 LDCM0488  CL93 HCT 116 C523(0.98)  LDD0805  [6]
 LDCM0489  CL94 HCT 116 C523(1.12)  LDD0806  [6]
 LDCM0490  CL95 HCT 116 C523(0.73)  LDD0807  [6]
 LDCM0491  CL96 HCT 116 C523(0.88)  LDD0808  [6]
 LDCM0492  CL97 HCT 116 C523(1.07)  LDD0809  [6]
 LDCM0493  CL98 HCT 116 C523(0.94)  LDD0810  [6]
 LDCM0494  CL99 HCT 116 C523(0.89)  LDD0811  [6]
 LDCM0495  E2913 HEK-293T C523(1.18); C539(1.21); C794(1.27); C407(1.11)  LDD1698  [11]
 LDCM0468  Fragment33 HCT 116 C572(0.44); C578(0.44)  LDD0785  [6]
 LDCM0427  Fragment51 HEK-293T C578(1.26)  LDD1025  [6]
 LDCM0022  KB02 HCT 116 C572(1.81); C578(1.81)  LDD0080  [6]
 LDCM0023  KB03 HCT 116 C572(3.64); C578(3.64)  LDD0081  [6]
 LDCM0024  KB05 HCT 116 C572(1.77); C578(1.77)  LDD0082  [6]
 LDCM0096  SAHA K562 20.00  LDD0269  [3]
 LDCM0021  THZ1 HCT 116 C572(1.06); C578(1.06)  LDD2173  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Polyamine-transporting ATPase 13A2 (ATP13A2) Cation transport ATPase (P-type) (TC 3.A.3) family Q9NQ11
Ubiquitin carboxyl-terminal hydrolase CYLD (CYLD) Peptidase C19 family Q9NQC7
Protein kinase C alpha type (PRKCA) AGC Ser/Thr protein kinase family P17252
Epidermal growth factor receptor (EGFR) Tyr protein kinase family P00533
E3 ubiquitin-protein ligase parkin (PRKN) RBR family, Parkin subfamily O60260
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Huntingtin (HTT) Huntingtin family P42858
Prominin-1 (PROM1) Prominin family O43490
Other
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Catenin beta-1 (CTNNB1) Beta-catenin family P35222
Breast cancer metastasis-suppressor 1 (BRMS1) BRMS1 family Q9HCU9
Myeloid differentiation primary response protein MyD88 (MYD88) . Q99836
Src substrate cortactin (CTTN) . Q14247
TAR DNA-binding protein 43 (TARDBP) . Q13148

The Drug(s) Related To This Target

Approved
Click To Hide/Show 7 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Decitabine Small molecular drug DB01262
Phenylbutyric Acid Small molecular drug DB06819
Propanoic Acid Small molecular drug DB03766
Romidepsin Small molecular drug DB06176
Valproic Acid Small molecular drug DB00313
Vorinostat Small molecular drug DB02546
Bufexamac . DB13346
Phase 1
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Citarinostat . D01WKZ
Ka2507 . D0O6SA
Investigative
Click To Hide/Show 94 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
(E)-8-biphenyl-4-yl-1-oxazol-2-yl-oct-7-en-1-one Small molecular drug D0KE3I
(S)-2-amino-n-cyclopentyl-7-mercaptoheptanamide Small molecular drug D01DOV
2-(Methylsulfonylthio)Ethyl 2-propylpentanoate Small molecular drug D0H1FZ
4-benzoylamino-n-hydroxy-benzamide Small molecular drug D09ZNU
4-butyrylamino-n-hydroxy-benzamide Small molecular drug D05LLX
4-chloro-n-(5-hydroxycarbamoyl-pentyl)-benzamide Small molecular drug D0A5LS
4-dimethylamino-n-(6-mercapto-hexyl)-benzamide Small molecular drug D06XNP
4-hydroxy-n-(5-hydroxycarbamoyl-pentyl)-benzamide Small molecular drug D04NSP
4-phenylbutyrohydroxamic Acid Small molecular drug D02NWS
5-(4-chloro-phenyl)-pentanoic Acid Hydroxyamide Small molecular drug D0V2ZO
5-(4-hydroxyphenyl)-3h-1,2-dithiole-3-thione Small molecular drug D06IQB
5-mercapto-pentanoic Acid Phenylamide Small molecular drug D0D2KE
6-(2-bromo-acetylamino)-hexanoic Acid Phenylamide Small molecular drug D02MQM
6-(9h-carbazol-9-yl)-n-hydroxyhexanamide Small molecular drug D06FAK
6-benzenesulfinylhexanoic Acid Hydroxamide Small molecular drug D00ZSD
6-benzenesulfonylhexanoic Acid Hydroxamide Small molecular drug D05AHZ
6-mercapto-hexanoic Acid Phenylamide Small molecular drug D0B3ZM
6-phenoxy-hexane-1-thiol Small molecular drug D09YBN
6-phenylsulfanylhexanoic Acid Hydroxamide Small molecular drug D0S9JF
7-(Biphenyl-3-yloxy)-1-oxazol-2-yl-heptan-1-one Small molecular drug D0B2ZJ
7-(Biphenyl-4-yloxy)-1,1,1-trifluoro-heptan-2-one Small molecular drug D0Z3BM
7-(Biphenyl-4-yloxy)-1-oxazol-2-yl-heptan-1-one Small molecular drug D02WZK
7-(Naphthalen-2-yloxy)-1-oxazol-2-yl-heptan-1-one Small molecular drug D05VFP
7-mercapto-heptanoic Acid Benzothiazol-2-ylamide Small molecular drug D0Z5KX
7-mercapto-heptanoic Acid Biphenyl-3-ylamide Small molecular drug D05XAN
7-mercapto-heptanoic Acid Biphenyl-4-ylamide Small molecular drug D01XWZ
7-mercapto-heptanoic Acid Phenylamide Small molecular drug D00SEE
7-mercapto-heptanoic Acid Pyridin-3-ylamide Small molecular drug D07FJU
7-mercapto-heptanoic Acid Quinolin-3-ylamide Small molecular drug D0T4IY
7-mercapto-n-(4-phenylthiazol-2-yl)Heptanamide Small molecular drug D02HVH
8-(Biphenyl-4-yloxy)-1,1,1-trifluoro-octan-2-one Small molecular drug D0AX7B
8-mercapto-octanoic Acid Phenylamide Small molecular drug D0XZ9Q
8-oxo-8-phenyl-octanoic Acid Small molecular drug D0RU1X
8-oxo-8-phenyl-octanoic Acid Hydroxyamide Small molecular drug D0S0WK
9,9,9-trifluoro-8-oxo-nonanoic Acid Phenylamide Small molecular drug D00KFF
9-(Biphenyl-4-yloxy)-1,1,1-trifluoro-nonan-2-one Small molecular drug D05FEJ
Abexinostat Small molecular drug DB12565
Cyclo(-l-am7(S2py)-a2in-l-ala-d-pro-) Small molecular drug D02NVY
Cyclo(-l-am7(S2py)-aib-l-ala-d-pro-) Small molecular drug D0R3XO
Cyclo(-l-am7(S2py)-aib-l-ala-d-tic-) Small molecular drug D0N5RV
Cyclo(-l-am7(S2py)-aib-l-ph4-d-pro-) Small molecular drug D0X4QC
Cyclo(-l-am7(S2py)-aib-l-ph5-d-pro-) Small molecular drug D03PRG
Cyclo(-l-am7(S2py)-aib-l-phe-d-pro-) Small molecular drug D0Z6MI
Cyclo(-l-am7(S2py)-aib-l-phg-d-pro-) Small molecular drug D0G1EX
Cyclo(-l-am7(S2py)-aib-l-ser(Bzl)-d-pro-) Small molecular drug D0E8UH
Cyclo(-l-am7(S2py)-aib-l-ser-d-pro-) Small molecular drug D0U0EZ
Cyclo(-l-am7(S2py)-d-2mephe-l-ala-d-pro-) Small molecular drug D04CDZ
Cyclo(-l-am7(S2py)-d-a1in-l-ala-d-pro-) Small molecular drug D02NAF
Cyclo(-l-am7(S2py)-l-2mephe-l-ala-d-pro-) Small molecular drug D0Z6HR
Cyclo(-l-am7(S2py)-l-a1in-l-ala-d-pro-) Small molecular drug D00XTC
Cyclostellettamine Derivative Small molecular drug D0C0VP
Droxinostat Small molecular drug D00VXM
N-(2-mercapto-ethyl)-n'-phenyl-oxalamide Small molecular drug D0F0KS
N-(2-mercapto-ethyl)-n'-phenyl-succinamide Small molecular drug D01MFV
N-(5-hydroxycarbamoyl-pentyl)-4-nitro-benzamide Small molecular drug D0C2KD
N-(6-hydroxycarbamoyl-hexyl)-benzamide Small molecular drug D0YY9M
N-(6-mercapto-hexyl)-benzamide Small molecular drug D04HSS
N-(Biphenyl-3-yl)-6-(Sulfamoylamino)Hexanamide Small molecular drug D0T8AJ
N-(Quinolin-3-yl)-6-(Sulfamoylamino)Hexanamide Small molecular drug D0XU0G
N-(Quinolin-6-yl)-6-(Sulfamoylamino)Hexanamide Small molecular drug D0Q4AV
N-(Quinolin-8-yl)-6-(Sulfamoylamino)Hexanamide Small molecular drug D0G3ZH
N-hydroxy-4-((R)-2-phenyl-butyrylamino)-benzamide Small molecular drug D04ZDI
N-hydroxy-4-((S)-2-phenyl-butyrylamino)-benzamide Small molecular drug D0QO0L
N-hydroxy-4-(2-phenyl-butyrylamino)-benzamide Small molecular drug D06VBN
N-hydroxy-4-(4-phenyl-butyrylamino)-benzamide Small molecular drug D0S7WQ
N-hydroxy-4-(5-phenyl-pentanoylamino)-benzamide Small molecular drug D0R5VG
N-hydroxy-4-(Pentanoylamino-methyl)-benzamide Small molecular drug D0Z7YS
N-hydroxy-4-(Phenylacetylamino-methyl)-benzamide Small molecular drug D02UTC
N-hydroxy-4-phenylacetylamino-benzamide Small molecular drug D01XXN
N-phenyl-6-(Sulfamoylamino)Hexanamide Small molecular drug D0R8JK
N-[5-(Formyl-hydroxy-amino)-pentyl]-benzamide Small molecular drug D0X4VO
N1-(Biphenyl-3-yl)-n8-hydroxyoctanediamide Small molecular drug D08XMS
N1-(Biphenyl-4-yl)-n8-hydroxyoctanediamide Small molecular drug D04DOL
N1-hydroxy-n8-(4-phenylthiazol-2-yl)Octanediamide Small molecular drug D0YP4F
Nexturastat A Small molecular drug D0Q5DI
Niltubacin Small molecular drug D0L7HP
Nqn-1 Small molecular drug D0Q4EG
Octanedioic Acid Bis-hydroxyamide Small molecular drug D07YZZ
Octanedioic Acid Hydroxyamide Pyridin-2-ylamide Small molecular drug D0E8KR
Octanedioic Acid Hydroxyamide Pyridin-4-ylamide Small molecular drug D04GGW
Pmid19111466c7d Small molecular drug D0G6DH
Pmid20947351c16 Small molecular drug D0MC9C
Pracinostat Small molecular drug DB05223
Psammaplin A Small molecular drug D0N0TS
Santacruzamate A Small molecular drug D09RKA
St-2741 Small molecular drug D05OVV
St-2986 Small molecular drug D0N9AK
St-2987 Small molecular drug D0T0SK
St-3050 Small molecular drug D01YBR
Thioacetic Acid S-(6-phenylcarbamoyl-hexyl) Ester Small molecular drug D05GVY
Tubacin Small molecular drug D04KQF
Ikh-25 . D00JIX
N-hydroxy-4-(3-phenyl-propionylamino)-benzamide . D0R4BS
Ucl-67022 . D0L0LR
Patented
Click To Hide/Show 77 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Diaryl Amine Derivative 2 Small molecular drug D0S7NE
Diaryl Amine Derivative 3 Small molecular drug D0KA3X
Diaryl Amine Derivative 4 Small molecular drug D0XN2W
Pmid28092474-compound-32a Small molecular drug D00XWZ
Pmid28092474-compound-32b Small molecular drug D04VQE
Pmid28092474-compound-32c Small molecular drug D0DH7R
Pmid28092474-compound-32d Small molecular drug D0N1RX
Pmid28092474-compound-32e Small molecular drug D0M7XL
Pmid28092474-compound-32f Small molecular drug D0S3ZB
Pmid28092474-compound-32g Small molecular drug D03EUD
Pmid28092474-compound-32h Small molecular drug D0EU5A
Pmid28092474-compound-32i Small molecular drug D0SK9K
Pmid28092474-compound-32j Small molecular drug D01LCZ
Pmid28092474-compound-32k Small molecular drug D0QF0Y
Pmid28092474-compound-32l Small molecular drug D0W1AX
Pmid28092474-compound-32m Small molecular drug D0MQ2D
Pmid28092474-compound-32n Small molecular drug D0O6SJ
Pmid28092474-compound-32o Small molecular drug D06IIL
Pmid28092474-compound-32p Small molecular drug D0MR7U
Pmid28092474-compound-32q Small molecular drug D0TH3L
Pmid28092474-compound-32r Small molecular drug D0ET4U
Pmid28092474-compound-32s Small molecular drug D0YC2M
Pmid28092474-compound-32t Small molecular drug D0CX1Y
Pmid28092474-compound-32u Small molecular drug D00GLJ
Pmid28092474-compound-32v Small molecular drug D08ZJZ
Pmid28092474-compound-32x Small molecular drug D04KQU
Pmid28092474-compound-32y Small molecular drug D0HM6Y
Pmid28092474-compound-32z Small molecular drug D02YDG
Pmid28092474-compound-33a Small molecular drug D00LLN
Pmid28092474-compound-33b Small molecular drug D04MVN
Pmid28092474-compound-33c Small molecular drug D0L3CU
Pmid28092474-compound-33d Small molecular drug D00ACL
Pmid28092474-compound-33e Small molecular drug D0CH4M
Pmid28092474-compound-33f Small molecular drug D0K2UF
Pmid28092474-compound-33g Small molecular drug D08GBR
Pmid28092474-compound-33h Small molecular drug D0JN0A
Pmid28092474-compound-33i Small molecular drug D0E5CO
Pmid28092474-compound-33j Small molecular drug D08GQL
Pmid28092474-compound-33k Small molecular drug D0Q9XK
Pmid28092474-compound-33l Small molecular drug D0SF8N
Pmid28092474-compound-33m Small molecular drug D08XLK
Pmid28092474-compound-33o Small molecular drug D0RD7T
Pmid28092474-compound-33p Small molecular drug D08SNJ
Pmid28092474-compound-34a Small molecular drug D0QN8W
Pmid28092474-compound-34b Small molecular drug D0BY1R
Pmid28092474-compound-34c Small molecular drug D04AMI
Pmid29671355-compound-11 Small molecular drug D0EH2K
Pmid29671355-compound-13 Small molecular drug D0ZG5X
Pmid29671355-compound-14 Small molecular drug D0N6WW
Pmid29671355-compound-15 Small molecular drug D0H5GP
Pmid29671355-compound-16 Small molecular drug D0TO3O
Pmid29671355-compound-18 Small molecular drug D0TN6E
Pmid29671355-compound-19 Small molecular drug D0LV6K
Pmid29671355-compound-21 Small molecular drug D0LP1K
Pmid29671355-compound-22 Small molecular drug D0QX3G
Pmid29671355-compound-23 Small molecular drug D00HXJ
Pmid29671355-compound-24 Small molecular drug D09PVH
Pmid29671355-compound-25 Small molecular drug D0RA0D
Pmid29671355-compound-26 Small molecular drug D0R3RJ
Pmid29671355-compound-27 Small molecular drug D0V5IQ
Pmid29671355-compound-28 Small molecular drug D0Z7QI
Pmid29671355-compound-31 Small molecular drug D0DI9S
Pmid29671355-compound-38a Small molecular drug D0JR9L
Pmid29671355-compound-38b Small molecular drug D0YD7B
Pmid29671355-compound-39 Small molecular drug D0L7HG
Pmid29671355-compound-43 Small molecular drug D0BP8I
Pmid29671355-compound-44 Small molecular drug D0N2DK
Pmid29671355-compound-56 Small molecular drug D0CH8Q
Pmid29671355-compound-61 Small molecular drug D0JB4S
Pmid29671355-compound-62 Small molecular drug D07WAT
Pmid29671355-compound-65a Small molecular drug D0F3TB
Pmid29671355-compound-67 Small molecular drug D0M0RE
Pmid29671355-compound-73 Small molecular drug D0T7OQ
Pmid29671355-compound-74 Small molecular drug D0N2FN
Pmid29671355-compound-8 Small molecular drug D0LN1T
Pmid29671355-compound-9 Small molecular drug D0Q1QY
Sulfonamide Derivative 16 Small molecular drug D05OKZ

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 Streamlined Target Deconvolution Approach Utilizing a Single Photoreactive Chloroalkane Capture Tag. ACS Chem Biol. 2021 Feb 19;16(2):404-413. doi: 10.1021/acschembio.0c00987. Epub 2021 Feb 5.
4 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
5 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
6 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
7 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
8 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
9 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
10 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
11 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402