Details of the Target
General Information of Target
| Target ID | LDTP10381 | |||||
|---|---|---|---|---|---|---|
| Target Name | Peroxisomal membrane protein 11C (PEX11G) | |||||
| Gene Name | PEX11G | |||||
| Gene ID | 92960 | |||||
| Synonyms |
PEX11C; Peroxisomal membrane protein 11C; Peroxin-11C; Peroxisomal biogenesis factor 11C; Protein PEX11 homolog gamma; PEX11-gamma |
|||||
| 3D Structure | ||||||
| Sequence |
MEGNGPAAVHYQPASPPRDACVYSSCYCEENIWKLCEYIKNHDQYPLEECYAVFISNERK
MIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQNFIYDLDTVLPFPCLFDTYVEDAFKSDD DIHPQFRRKFRVIRADSYLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFIS MDPKVGWGAVYTLSEFTHRFGSKNC |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Peroxin-11 family
|
|||||
| Subcellular location |
Peroxisome membrane
|
|||||
| Function | Promotes membrane protrusion and elongation on the peroxisomal surface. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C106(0.86) | LDD1508 | [1] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C166 Probe Info |
![]() |
7.41 | LDD1846 | [2] | |
|
C226 Probe Info |
![]() |
5.58 | LDD1899 | [2] | |
|
C274 Probe Info |
![]() |
5.86 | LDD1944 | [2] | |
|
C275 Probe Info |
![]() |
6.45 | LDD1945 | [2] | |
|
C277 Probe Info |
![]() |
14.72 | LDD1947 | [2] | |
|
C285 Probe Info |
![]() |
28.44 | LDD1955 | [2] | |
|
C286 Probe Info |
![]() |
19.84 | LDD1956 | [2] | |
|
C287 Probe Info |
![]() |
10.20 | LDD1957 | [2] | |
|
C288 Probe Info |
![]() |
13.45 | LDD1958 | [2] | |
|
C289 Probe Info |
![]() |
37.27 | LDD1959 | [2] | |
|
C290 Probe Info |
![]() |
16.56 | LDD1960 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0215 | AC10 | HEK-293T | C106(0.86) | LDD1508 | [1] |
| LDCM0277 | AC18 | HEK-293T | C106(0.98) | LDD1516 | [1] |
| LDCM0279 | AC2 | HEK-293T | C106(0.99) | LDD1518 | [1] |
| LDCM0286 | AC26 | HEK-293T | C106(0.94) | LDD1525 | [1] |
| LDCM0295 | AC34 | HEK-293T | C106(0.94) | LDD1534 | [1] |
| LDCM0304 | AC42 | HEK-293T | C106(0.99) | LDD1543 | [1] |
| LDCM0313 | AC50 | HEK-293T | C106(0.81) | LDD1552 | [1] |
| LDCM0321 | AC58 | HEK-293T | C106(0.97) | LDD1560 | [1] |
| LDCM0405 | CL18 | HEK-293T | C106(0.77) | LDD1609 | [1] |
| LDCM0419 | CL30 | HEK-293T | C106(0.77) | LDD1623 | [1] |
| LDCM0432 | CL42 | HEK-293T | C106(0.85) | LDD1636 | [1] |
| LDCM0445 | CL54 | HEK-293T | C106(0.93) | LDD1648 | [1] |
| LDCM0451 | CL6 | HEK-293T | C106(0.95) | LDD1654 | [1] |
| LDCM0458 | CL66 | HEK-293T | C106(0.83) | LDD1661 | [1] |
| LDCM0471 | CL78 | HEK-293T | C106(0.81) | LDD1674 | [1] |
| LDCM0485 | CL90 | HEK-293T | C106(0.97) | LDD1688 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Lysoplasmalogenase TMEM86B (TMEM86B) | TMEM86 family | Q8N661 | |||
Transporter and channel
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) | ERGIC family | Q9Y282 | |||
References












